BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30945 (623 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11080.1 68417.m01800 high mobility group (HMG1/2) family pro... 38 0.004 At3g24550.1 68416.m03083 protein kinase family protein contains ... 31 0.82 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 31 0.82 At1g55810.3 68414.m06396 uracil phosphoribosyltransferase, putat... 29 2.5 At1g55810.2 68414.m06395 uracil phosphoribosyltransferase, putat... 29 2.5 At1g55810.1 68414.m06394 uracil phosphoribosyltransferase, putat... 29 2.5 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 29 3.3 At3g10960.1 68416.m01321 xanthine/uracil permease family protein... 28 5.8 At2g27580.1 68415.m03342 zinc finger (AN1-like) family protein c... 28 5.8 At1g58070.1 68414.m06581 expressed protein 27 7.7 >At4g11080.1 68417.m01800 high mobility group (HMG1/2) family protein similar to SP|P40618 High mobility group protein HMG2A {Gallus gallus}; contains Pfam profile PF00505: HMG (high mobility group) box Length = 446 Score = 38.3 bits (85), Expect = 0.004 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 2 KGQNPNASFGEVSKIVASMWDGLDSEHKSVYKQK 103 K QNP A F E S I+ + W G+ +E K Y++K Sbjct: 148 KKQNPEADFKETSNILGAKWKGISAEEKKPYEEK 181 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 30.7 bits (66), Expect = 0.82 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = +3 Query: 426 PSQYDNCSPNIPECS--SPITTGLSNKLFKSNQNCQPNVAQSPRNYQPTQSPTNYPASSS 599 PS + +P +P+ S +PIT + SN P+ Q P N P+ S P+++ Sbjct: 67 PSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPPN-TPSGSTPRTPSNTK 125 Query: 600 MSPP 611 SPP Sbjct: 126 PSPP 129 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 30.7 bits (66), Expect = 0.82 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 543 SPRNYQPTQSPTNYPASSSMSPPGY 617 SPR Y P+ SP Y +SS PP Y Sbjct: 588 SPREYYPSPSPPYYQYTSSPPPPTY 612 >At1g55810.3 68414.m06396 uracil phosphoribosyltransferase, putative / UMP pyrophosphorylase, putative / UPRTase, putative similar to SP|O65583 Uracil phosphoribosyltransferase (EC 2.4.2.9) (UMP pyrophosphorylase) (UPRTase) {Arabidopsis thaliana}; contains Pfam profile PF00485: Phosphoribulokinase / Uridine kinase family Length = 466 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -2 Query: 394 DTVELARDMRVVADQVSNFAESIFE 320 DTVE RD+ V DQ S F + FE Sbjct: 186 DTVEKGRDIATVLDQYSKFVKPAFE 210 >At1g55810.2 68414.m06395 uracil phosphoribosyltransferase, putative / UMP pyrophosphorylase, putative / UPRTase, putative similar to SP|O65583 Uracil phosphoribosyltransferase (EC 2.4.2.9) (UMP pyrophosphorylase) (UPRTase) {Arabidopsis thaliana}; contains Pfam profile PF00485: Phosphoribulokinase / Uridine kinase family Length = 466 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -2 Query: 394 DTVELARDMRVVADQVSNFAESIFE 320 DTVE RD+ V DQ S F + FE Sbjct: 186 DTVEKGRDIATVLDQYSKFVKPAFE 210 >At1g55810.1 68414.m06394 uracil phosphoribosyltransferase, putative / UMP pyrophosphorylase, putative / UPRTase, putative similar to SP|O65583 Uracil phosphoribosyltransferase (EC 2.4.2.9) (UMP pyrophosphorylase) (UPRTase) {Arabidopsis thaliana}; contains Pfam profile PF00485: Phosphoribulokinase / Uridine kinase family Length = 466 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -2 Query: 394 DTVELARDMRVVADQVSNFAESIFE 320 DTVE RD+ V DQ S F + FE Sbjct: 186 DTVEKGRDIATVLDQYSKFVKPAFE 210 >At1g79480.1 68414.m09263 hypothetical protein low similarity to beta-1,3-glucanase-like protein GI:9758115 from [Arabidopsis thaliana] Length = 356 Score = 28.7 bits (61), Expect = 3.3 Identities = 21/54 (38%), Positives = 24/54 (44%) Frame = +3 Query: 450 PNIPECSSPITTGLSNKLFKSNQNCQPNVAQSPRNYQPTQSPTNYPASSSMSPP 611 PN PE SS S+ SN N PN +S N P + N P SSS P Sbjct: 129 PNPPESSSNPNPPDSS----SNPNSNPNPPESSSNPNPPVTVPNPPESSSNPNP 178 >At3g10960.1 68416.m01321 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 579 Score = 27.9 bits (59), Expect = 5.8 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 8/60 (13%) Frame = -2 Query: 325 FEGKHFAHSSEANDYFHKSVLGSSTVCGATVSSTHI--------TIISVVVHCLVFLFST 170 F G++FA S+A+ S+LG+S V SST I T I+V V+ L+ +F T Sbjct: 414 FAGQYFAFMSDASAIVIGSLLGTSPVTVFIESSTGIREGGRTGLTAITVAVYFLLAMFFT 473 >At2g27580.1 68415.m03342 zinc finger (AN1-like) family protein contains Pfam domains, PF01428: AN1-like Zinc finger and PF01754: A20-like zinc finger Length = 163 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = +3 Query: 444 CSPNIPECSSPITTGLSNKLFKSNQNCQPNVAQSPRNYQPTQSPTNYPASSSMSPP 611 C+ N S T L +K F+ Q+ + N + + + + ASSS+SPP Sbjct: 13 CANNCGFFGSTATQNLCSKCFRDLQHQEQNSSTAKHALTQSLAAVGAAASSSVSPP 68 >At1g58070.1 68414.m06581 expressed protein Length = 284 Score = 27.5 bits (58), Expect = 7.7 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +3 Query: 447 SPNIPECSSPITTGLSNKLFKSNQNCQPNVAQSPRNYQPTQSPT-NYPASSSMSP 608 S +I + + P + GLS + P+++Q+ + P SP+ + ASSS SP Sbjct: 57 SRSINQNAKPRSPGLSQTVKLVIPTASPSISQTAKLVSPIASPSISQTASSSSSP 111 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,213,603 Number of Sequences: 28952 Number of extensions: 219332 Number of successful extensions: 734 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 734 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -