BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30944X (487 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 25 0.43 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 7.0 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 7.0 AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 21 9.2 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 21 9.2 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 25.0 bits (52), Expect = 0.43 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 296 RTMCKMLPLKDTLRKITHLVSHNPHIPGQLNSIHLT 403 +T+ K++ DTLRKI NP P ++ LT Sbjct: 890 QTLDKLIRSPDTLRKIAQNRGTNPLAPDAVDLTQLT 925 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.0 bits (42), Expect = 7.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 274 KSVLGSSTVCGATVSSTHITII 209 K VL SST + ++ST TI+ Sbjct: 320 KPVLSSSTTTTSPMTSTKSTIV 341 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 7.0 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 320 LKDTLRKITHLVSHNPHIPGQLNSIH 397 LKD+ K T +S +P+ Q+N H Sbjct: 672 LKDSRIKTTEKLSTDPNTHFQVNQSH 697 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 20.6 bits (41), Expect = 9.2 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -1 Query: 442 LSYWLGNFEEIV 407 LSYW GN ++ Sbjct: 70 LSYWRGNLANVI 81 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 20.6 bits (41), Expect = 9.2 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -1 Query: 442 LSYWLGNFEEIV 407 LSYW GN ++ Sbjct: 70 LSYWRGNLANVI 81 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,045 Number of Sequences: 438 Number of extensions: 1883 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13297932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -