BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30943 (685 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16640.1 68416.m02127 translationally controlled tumor family... 56 2e-08 At3g05540.1 68416.m00607 translationally controlled tumor family... 55 5e-08 At4g29060.1 68417.m04157 elongation factor Ts family protein sim... 34 0.076 At2g17050.1 68415.m01968 disease resistance protein (TIR-NBS-LRR... 31 0.71 At1g63910.1 68414.m07236 myb family transcription factor (MYB103... 29 2.9 At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to ... 28 6.6 At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to ... 28 6.6 At5g49030.1 68418.m06067 tRNA synthetase class I (I, L, M and V)... 27 8.8 At1g26900.1 68414.m03280 pentatricopeptide (PPR) repeat-containi... 27 8.8 >At3g16640.1 68416.m02127 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 168 Score = 56.4 bits (130), Expect = 2e-08 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 3/69 (4%) Frame = +2 Query: 59 MKIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGRLVTRAQGDIQIEGFNPSAEEA--DEG 229 M +Y+D++TGDE+ SD++ K ++ +++EV G+ VT D+ I G NPSAEE DEG Sbjct: 1 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVTVGAVDVNI-GANPSAEEGGEDEG 59 Query: 230 TDSAVESGV 256 D + + V Sbjct: 60 VDDSTQKVV 68 Score = 52.8 bits (121), Expect = 2e-07 Identities = 33/84 (39%), Positives = 43/84 (51%) Frame = +1 Query: 256 DIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGR 435 DIV RL E + DKK + Y+K Y+K L KL E+ DQ VFK + K +L R Sbjct: 69 DIVDTFRLQEQPTY-DKKGFIAYIKKYIKLLTPKLSEE--DQA-VFKKGIEGATKFLLPR 124 Query: 436 FKELQFFTGESMDCDGMVAMMEYR 507 + QFF GE M D + Y+ Sbjct: 125 LSDFQFFVGEGMHDDSTLVFAYYK 148 >At3g05540.1 68416.m00607 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 156 Score = 54.8 bits (126), Expect = 5e-08 Identities = 30/85 (35%), Positives = 50/85 (58%), Gaps = 1/85 (1%) Frame = +1 Query: 256 DIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGR 435 DI+ RL E +F DKK + +++K Y+K+L KL+ + E+FK ++ K ++ + Sbjct: 56 DIIDTFRLQEQPSF-DKKQFVMFMKRYIKQLSPKLDS---ENQELFKKHIESATKFLMSK 111 Query: 436 FKELQFFTGESMDC-DGMVAMMEYR 507 K+ QFF GESM+ +G + YR Sbjct: 112 LKDFQFFVGESMEGEEGSLVFAYYR 136 Score = 36.7 bits (81), Expect = 0.014 Identities = 18/52 (34%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = +2 Query: 59 MKIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGRLVTRAQGDIQIEGFNPSA 211 M +Y+DI+TGDE+ SD++ K ++ +++EV G+ + +G + EG + A Sbjct: 1 MLVYQDILTGDELLSDSFPYKEIENGMLWEVEGKNPSGEEGG-EDEGVDDQA 51 >At4g29060.1 68417.m04157 elongation factor Ts family protein similar to SP|P35019 Elongation factor Ts (EF-Ts) {Galdieria sulphuraria}; contains Pfam profiles PF00627: UBA/TS-N domain, PF00889: Elongation factor TS, PF00575: S1 RNA binding domain Length = 953 Score = 34.3 bits (75), Expect = 0.076 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = +2 Query: 86 GDEMFSDTYKMKLVDEVIYEVT--GRLVTRAQGDIQIEGFNPSAEEADEGTDSAVESG 253 G+ S K +++D V+ +T G +T +G+ EGF P+AEEAD+G S + G Sbjct: 238 GEGFNSKFAKGQMLDGVVKNLTRSGAFITIGEGE---EGFLPTAEEADDGIGSMMMGG 292 >At2g17050.1 68415.m01968 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1355 Score = 31.1 bits (67), Expect = 0.71 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +1 Query: 331 DYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQ-FFTGESMD 474 D M+ + KL P +EVFK+N N + ++ F ++ FF GE D Sbjct: 226 DKMEVKLLKLNHPPPQIMEVFKSNYNALNENEKSMFLDIACFFRGEKAD 274 >At1g63910.1 68414.m07236 myb family transcription factor (MYB103) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 370 Score = 29.1 bits (62), Expect = 2.9 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = -1 Query: 169 SRHQPTGHFVNNFIDQFHFVSVREHLITSDNVLIDLHFDGLEAIKNNKNRKN 14 SRHQP+ V D + E T+ + + +LHFDG N N N Sbjct: 124 SRHQPSVTTVTLNADTTSIATTIEASTTTTSTIDNLHFDGFTDSPNQLNFTN 175 >At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 383 Score = 27.9 bits (59), Expect = 6.6 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 517 PSKLYIPSWQPCHHNPWTP 461 P + + P WQP H N W P Sbjct: 79 PPQNHYPPWQPHHGNQWRP 97 >At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 661 Score = 27.9 bits (59), Expect = 6.6 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 517 PSKLYIPSWQPCHHNPWTP 461 P + + P WQP H N W P Sbjct: 79 PPQNHYPPWQPHHGNQWRP 97 >At5g49030.1 68418.m06067 tRNA synthetase class I (I, L, M and V) family protein similar to SP|P41972 Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA ligase) (IleRS) {Staphylococcus aureus}; contains Pfam profile PF00133: tRNA synthetases class I (I, L, M and V) Length = 1093 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +1 Query: 403 MNKVMKDILGRFKELQFFTGE---SMDCDGM 486 +NK++KDI+ R+K LQ + + DC G+ Sbjct: 167 LNKILKDIINRYKLLQNYKVQYVPGWDCHGL 197 >At1g26900.1 68414.m03280 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 572 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +3 Query: 549 HGLEEEKF*MLDKK*LNNSKLAP*YFCFLFIYQSCPHPG 665 HGL E + +K N K+ P FL + +C H G Sbjct: 407 HGLAREAVTLFNKMEEENCKVRPNEITFLVVLNACSHGG 445 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,502,633 Number of Sequences: 28952 Number of extensions: 290275 Number of successful extensions: 730 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 728 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -