BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30941X (460 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 27 0.097 DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 23 1.6 AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. 21 4.8 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 8.5 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 27.1 bits (57), Expect = 0.097 Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 4/69 (5%) Frame = -3 Query: 290 PYHYLYNDNVVTA-MAAGAI*LCFDVHGCYKLTK---KWSVSSFAFEIIKNLRLSPSAFN 123 PYH + +T + G +C+ C + K +S AF+++ L S SAFN Sbjct: 262 PYHVSDHKAAITVGVIMGVFLICWVPFFCVNIVTSYCKTCISGRAFQVLTWLGYSNSAFN 321 Query: 122 DSLHFVVST 96 ++ + +T Sbjct: 322 PIIYSIFNT 330 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 23.0 bits (47), Expect = 1.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 279 IVIRLLCVCIVSYVKTR 329 IVI L +CIVSY+ R Sbjct: 4 IVILLFTLCIVSYMMVR 20 >AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. Length = 50 Score = 21.4 bits (43), Expect = 4.8 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +3 Query: 321 KTREKETKNFASCYLWKGRCFIRPK 395 K R K+ N +W C I+PK Sbjct: 8 KKRRKKNLNQNQMMIWALDCSIKPK 32 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 20.6 bits (41), Expect = 8.5 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -1 Query: 409 IEASTFGRIKHRPF 368 + A T G+ +HRPF Sbjct: 408 LHALTSGKCEHRPF 421 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,578 Number of Sequences: 438 Number of extensions: 2385 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12189771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -