BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30940 (679 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 23 3.0 AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochr... 23 3.0 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 22 5.3 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -1 Query: 679 SRSPAFSESKRFVPIASSSSMKMIAGAFSLANAKASRT 566 S +PAFSE + V +S + F L+ A R+ Sbjct: 12 SSAPAFSEQRGGVISEGVASSLQVVALFQLSETTAPRS 49 >AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 124 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +1 Query: 286 AMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKF 402 ++ V ER E +IGG D + + M H EK+ Sbjct: 60 SVPVIERRLEVDCNIGGYDFPKDTFLSLFIYGMHHNEKY 98 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 21.8 bits (44), Expect = 5.3 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = -1 Query: 580 KASRTSLAPSPMNICTSCGP 521 K S+ +++ + + C SCGP Sbjct: 31 KRSKFAISENAVKPCVSCGP 50 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,722 Number of Sequences: 336 Number of extensions: 3752 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -