BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30940 (679 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 26 1.3 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 8.9 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 25.8 bits (54), Expect = 1.3 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 553 MVPSLSATPLHWLKRRHQQSSSLMN-WTLLVQSVLIQKRLETV 678 +VPS+ + W R HQ +L++ W L+ + ++ LE + Sbjct: 503 VVPSIRSAASEWNPRAHQPMIALLDAWAPLLPAWILDNVLEQI 545 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 332 PISEYCSVGLSSTSIAFTLA 273 PI+ +CS G+ T + TL+ Sbjct: 1158 PITVHCSAGVGRTGVFITLS 1177 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,576 Number of Sequences: 2352 Number of extensions: 16459 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -