BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30931 (664 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0308 - 22977542-22978174,22978202-22978387 29 3.3 07_01_1098 - 10083800-10084447,10084523-10084792 29 4.4 02_02_0461 + 10534733-10536302,10536347-10536396,10536845-10538227 28 5.8 >03_05_0308 - 22977542-22978174,22978202-22978387 Length = 272 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 190 KINSLKFYILISGYRKRYGMMTHKSVCC*KETEHASEFLENLK 318 +I+SLKF L Y R GMM K EH S+ E L+ Sbjct: 57 EIDSLKFQQLSDQYNDRRGMMDTLEEQLRKSQEHVSQLEEQLR 99 >07_01_1098 - 10083800-10084447,10084523-10084792 Length = 305 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/59 (25%), Positives = 28/59 (47%) Frame = +1 Query: 157 INRFDRQLSDIKINSLKFYILISGYRKRYGMMTHKSVCC*KETEHASEFLENLKILSIN 333 + + +L+D+ ++ +F L Y R GMM + EH S+ E L+ +I+ Sbjct: 79 MGELETELTDLSVHGDQFKQLSDQYNDRRGMMDSLEEQLRESQEHVSQLEEQLRAATIS 137 >02_02_0461 + 10534733-10536302,10536347-10536396,10536845-10538227 Length = 1000 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -3 Query: 176 CRSNLLIYNVSNNNKKTKKQHAICDFNKIMSYLKGI*FICM 54 C L IY + K T QH IC +++MS+ I +IC+ Sbjct: 232 CIPVLPIYGIGGVGKTTLAQH-ICHDSRVMSHFDPIIWICV 271 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,538,950 Number of Sequences: 37544 Number of extensions: 229820 Number of successful extensions: 444 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 444 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1667659452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -