BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30931 (664 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13700| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 >SB_13700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 450 Score = 32.3 bits (70), Expect = 0.36 Identities = 21/80 (26%), Positives = 34/80 (42%) Frame = -2 Query: 552 NSSTFSWYC*CPENISR*SGFECNKNEIICKSKNYMITFKNTVELQLEIFYCFHEILRHA 373 N + S+ C P+N+ G +C KN IC ++ + T E + I Sbjct: 249 NDADVSYRCYNPDNVDDRFGIQCTKNGKICPRNSHFPSEGGTFENNALVCKFMKVIYIIR 308 Query: 372 PSLCSNTQIYDVIINRQYFE 313 P+L +I+DV I Y + Sbjct: 309 PTLPRYKEIWDVSIVFNYLK 328 >SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 31.5 bits (68), Expect = 0.63 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 345 KSVYCCKETEHASEFHENNKIFPIVILRYF 434 +SVYCC+ T H E N I +V L+ F Sbjct: 46 RSVYCCRSTPHYGETTSLNNILKVVSLQSF 75 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,953,820 Number of Sequences: 59808 Number of extensions: 303881 Number of successful extensions: 669 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 669 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -