BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30922 (467 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. 35 5e-04 DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 33 0.001 DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. 25 0.31 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 1.6 DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 22 2.9 AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 22 3.8 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 5.0 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 5.0 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 21 5.0 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 21 5.0 >DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. Length = 135 Score = 34.7 bits (76), Expect = 5e-04 Identities = 15/56 (26%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +1 Query: 46 SECVKESGVSTEVINAAKTGQYS-EDKAFKKFVLCFFNKSAILNSDGTLNMDVALE 210 S C+ ++G++ ++IN G+ + ED+ + ++ C K + ++ DG N V+ E Sbjct: 31 SICMAKTGINKQIINDVNDGKINIEDENVQLYIECAMKKFSFVDKDGNFNEHVSRE 86 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 33.5 bits (73), Expect = 0.001 Identities = 12/51 (23%), Positives = 27/51 (52%) Frame = +1 Query: 22 KEKAKQYTSECVKESGVSTEVINAAKTGQYSEDKAFKKFVLCFFNKSAILN 174 +E +Y +C+ E+ + E + A + G++ ED+ K + C K +++ Sbjct: 33 REMTSKYRKKCIGETKTTIEDVEATEYGEFPEDEKLKCYFNCVLEKFNVMD 83 Score = 20.6 bits (41), Expect = 8.7 Identities = 6/22 (27%), Positives = 11/22 (50%) Frame = +2 Query: 260 CKDKTGQDAADKAFEIFQCYYK 325 C + D +K+F +C Y+ Sbjct: 113 CSNVDSSDKCEKSFMFMKCMYE 134 >DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. Length = 132 Score = 25.4 bits (53), Expect = 0.31 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +2 Query: 245 KRTKQCKDKTGQDAADKAFEIFQCY 319 K +CK +D +KA+++ +CY Sbjct: 94 KLFNKCKSIQNEDPCEKAYQLVKCY 118 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 1.6 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 279 KTQPIKPSRSSNATTKGPRHIFYF 350 KT K R +T+K PR F+F Sbjct: 423 KTHVWKKGRDKKSTSKKPRRKFHF 446 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 22.2 bits (45), Expect = 2.9 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +2 Query: 260 CKDKTGQDAADKAFEIFQCY 319 CKD T ++ K+ ++ QC+ Sbjct: 103 CKDITESNSCKKSSKLLQCF 122 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +2 Query: 263 KDKTGQDAADKAFEIFQCYYKGTKTHILF 349 ++ TG D K ++ QC+YK F Sbjct: 115 EEYTGDDC-QKTYQYVQCHYKQNPEKFFF 142 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 5.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 22 KEKAKQYTSECVKESGVSTEVINAAKTGQY 111 KE +YT+E + GVS E + K Y Sbjct: 432 KENLPKYTTEELNFPGVSIESVTVDKLITY 461 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 5.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 22 KEKAKQYTSECVKESGVSTEVINAAKTGQY 111 KE +YT+E + GVS E + K Y Sbjct: 432 KENLPKYTTEELNFPGVSIESVTVDKLITY 461 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 21.4 bits (43), Expect = 5.0 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +1 Query: 166 ILNSDGTLNMDVALEN 213 IL ++ T+N+DV L+N Sbjct: 87 ILINNATINIDVTLQN 102 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 21.4 bits (43), Expect = 5.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 22 KEKAKQYTSECVKESGVSTEVINAAKTGQY 111 KE +YT+E + GVS E + K Y Sbjct: 58 KENLPKYTTEELNFPGVSIESVTVDKLITY 87 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,091 Number of Sequences: 438 Number of extensions: 2057 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12559158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -