BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30920X (412 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119190-1|AAM51050.1| 449|Drosophila melanogaster SD11486p pro... 31 0.78 AE014296-1406|AAF50459.2| 449|Drosophila melanogaster CG7213-PA... 31 0.78 AY118435-1|AAM48464.1| 248|Drosophila melanogaster RH43654p pro... 29 2.4 AY071462-1|AAL49084.1| 248|Drosophila melanogaster RE54270p pro... 29 2.4 AE014297-2011|AAF55172.2| 248|Drosophila melanogaster CG31478-P... 29 2.4 BT010226-1|AAQ23544.1| 2240|Drosophila melanogaster RE72677p pro... 28 4.2 EF120977-1|ABO93155.1| 1349|Drosophila melanogaster misfire prot... 28 5.5 AE014296-2674|AAS64988.1| 207|Drosophila melanogaster CG13067-P... 28 5.5 AF038582-1|AAB97002.1| 425|Drosophila melanogaster QKR54B protein. 27 9.7 >AY119190-1|AAM51050.1| 449|Drosophila melanogaster SD11486p protein. Length = 449 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +2 Query: 20 INYNLLSLCGRFHLDESLLEVAFCASVCKGSTFDIRQTHLLF 145 +N L+L + L ++ +V +SVC G T+DI+ + L F Sbjct: 114 VNVKCLNLLLQSELQRAISKVKTASSVCSGRTYDIKYSVLTF 155 >AE014296-1406|AAF50459.2| 449|Drosophila melanogaster CG7213-PA protein. Length = 449 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +2 Query: 20 INYNLLSLCGRFHLDESLLEVAFCASVCKGSTFDIRQTHLLF 145 +N L+L + L ++ +V +SVC G T+DI+ + L F Sbjct: 114 VNVKCLNLLLQSELQRAISKVKTASSVCSGRTYDIKYSVLTF 155 >AY118435-1|AAM48464.1| 248|Drosophila melanogaster RH43654p protein. Length = 248 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 299 LQCGRLKVRLHPWSTSDSMSLP 234 L+ RLK RLH WST S LP Sbjct: 204 LEQARLKCRLHHWSTDPSERLP 225 >AY071462-1|AAL49084.1| 248|Drosophila melanogaster RE54270p protein. Length = 248 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 299 LQCGRLKVRLHPWSTSDSMSLP 234 L+ RLK RLH WST S LP Sbjct: 204 LEQARLKCRLHHWSTDPSERLP 225 >AE014297-2011|AAF55172.2| 248|Drosophila melanogaster CG31478-PA protein. Length = 248 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 299 LQCGRLKVRLHPWSTSDSMSLP 234 L+ RLK RLH WST S LP Sbjct: 204 LEQARLKCRLHHWSTDPSERLP 225 >BT010226-1|AAQ23544.1| 2240|Drosophila melanogaster RE72677p protein. Length = 2240 Score = 28.3 bits (60), Expect = 4.2 Identities = 12/55 (21%), Positives = 25/55 (45%) Frame = +1 Query: 169 NRIKYEGVCSHRCLSGSGCAGRGRLMLSDVDQGCRRTLSLPHCSAYYGQFKDNHV 333 N + Y G+ + C+ G+G + +++ D D+G + Y +F +V Sbjct: 928 NALTYVGLINENCVVGTGLSMNHAILIQDADEGPNAEFRVQLQGDYSDEFSIEYV 982 >EF120977-1|ABO93155.1| 1349|Drosophila melanogaster misfire protein. Length = 1349 Score = 27.9 bits (59), Expect = 5.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 135 CV*RMSKVLPLHTLAQKATSNNDSSR 58 CV R S+++P HTL+ K D +R Sbjct: 14 CVLRRSRLMPTHTLSSKTVPGLDETR 39 >AE014296-2674|AAS64988.1| 207|Drosophila melanogaster CG13067-PB, isoform B protein. Length = 207 Score = 27.9 bits (59), Expect = 5.5 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 207 PVWLWVCWPRKTHAIR 254 P+W W+C P TH +R Sbjct: 115 PIWEWMCIPMATHHLR 130 >AF038582-1|AAB97002.1| 425|Drosophila melanogaster QKR54B protein. Length = 425 Score = 27.1 bits (57), Expect = 9.7 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 158 RILEKITSAFDVCRKYCLYTHWRRRRLPTMTRLDENVRTKTTDC 27 RIL T F R+ C HWRR + RL ++++ C Sbjct: 382 RILSAFTRLFCWRRRRCRSGHWRRFSIKCHRRLWSQFQSQSQPC 425 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,598,375 Number of Sequences: 53049 Number of extensions: 389086 Number of successful extensions: 931 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 931 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1209331668 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -