BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30920X (412 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92803-13|CAB07249.2| 331|Caenorhabditis elegans Hypothetical p... 30 0.57 AL021482-4|CAA16341.2| 331|Caenorhabditis elegans Hypothetical ... 30 0.57 Z70780-10|CAA94827.1| 330|Caenorhabditis elegans Hypothetical p... 27 5.3 AF039043-1|AAB94194.1| 5105|Caenorhabditis elegans Hypothetical ... 26 9.2 >Z92803-13|CAB07249.2| 331|Caenorhabditis elegans Hypothetical protein K01G5.9 protein. Length = 331 Score = 30.3 bits (65), Expect = 0.57 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +1 Query: 175 IKYEGVCSHRCLSGSGCAGRGRLMLSDVDQGCRRTLSLPHCSAYYGQ 315 +K+ G H C+ GSG R DQ RT+S+ CS +G+ Sbjct: 182 LKHSGRLGHSCVYGSGTWSERRQYEEPFDQVSERTISI--CSTGHGE 226 >AL021482-4|CAA16341.2| 331|Caenorhabditis elegans Hypothetical protein K01G5.9 protein. Length = 331 Score = 30.3 bits (65), Expect = 0.57 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +1 Query: 175 IKYEGVCSHRCLSGSGCAGRGRLMLSDVDQGCRRTLSLPHCSAYYGQ 315 +K+ G H C+ GSG R DQ RT+S+ CS +G+ Sbjct: 182 LKHSGRLGHSCVYGSGTWSERRQYEEPFDQVSERTISI--CSTGHGE 226 >Z70780-10|CAA94827.1| 330|Caenorhabditis elegans Hypothetical protein F46B6.11 protein. Length = 330 Score = 27.1 bits (57), Expect = 5.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 173 ASNMKVYALIVACLALGVLAEEDSCY 250 +SN+ Y ++ C+AL V A SCY Sbjct: 275 SSNLYAYMFLLRCIALDVRAHIVSCY 300 >AF039043-1|AAB94194.1| 5105|Caenorhabditis elegans Hypothetical protein F39C12.1 protein. Length = 5105 Score = 26.2 bits (55), Expect = 9.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 266 PWSTSDSMSLPRPAHPEPDR 207 P S SLPRPA P P++ Sbjct: 3386 PLQLSGDSSLPRPAQPSPEK 3405 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,387,555 Number of Sequences: 27780 Number of extensions: 192366 Number of successful extensions: 441 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 441 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 662437636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -