BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30917 (724 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g52950.1 68418.m06570 expressed protein ; expression supporte... 28 5.5 At5g66380.1 68418.m08370 mitochondrial substrate carrier family ... 28 7.2 At3g49140.1 68416.m05370 pentatricopeptide (PPR) repeat-containi... 28 7.2 >At5g52950.1 68418.m06570 expressed protein ; expression supported by MPSS Length = 945 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 70 QASSVALRTLRQRTATED*ICETPLWLVETR 162 Q A R QR+ D +CETP+ +ET+ Sbjct: 885 QQQRTAKRKKEQRSVEYDRVCETPMTTIETK 915 >At5g66380.1 68418.m08370 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 308 Score = 27.9 bits (59), Expect = 7.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 127 ICETPLWLVETRSYAETP 180 +C P+WLV+TR +TP Sbjct: 122 LCTNPIWLVKTRLQLQTP 139 >At3g49140.1 68416.m05370 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 1229 Score = 27.9 bits (59), Expect = 7.2 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 88 LRTLRQRTATED*ICETPLWLVETRSYAETPDLSSSKR 201 LRT+ R ED C + L + R+YA D++S+++ Sbjct: 58 LRTVHSRIILEDLRCNSSLGVKLMRAYASLKDVASARK 95 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,119,109 Number of Sequences: 28952 Number of extensions: 233951 Number of successful extensions: 508 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1575119672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -