BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30912 (762 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 24 1.2 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 23 3.5 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 24.2 bits (50), Expect = 1.2 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 627 PLFTGLSLNSYILKIQFFTIFYWSKYNIFSTTFFRFSWNTSTIF 758 P++ GLS I++ SK NI S+ F R N TIF Sbjct: 60 PIY-GLSTKPKIMQGAISNHIQGSKPNILSSAFPRLKRNARTIF 102 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/35 (22%), Positives = 17/35 (48%) Frame = +3 Query: 654 SYILKIQFFTIFYWSKYNIFSTTFFRFSWNTSTIF 758 SYI+ F FY+ + +F + + + T++ Sbjct: 286 SYIILTSFLNNFYFIIFQVFESFYLHKATTLETVY 320 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,528 Number of Sequences: 336 Number of extensions: 2788 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -