BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30912 (762 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 5.9 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 7.8 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -2 Query: 197 LYQILVKLKYKLQDVQKIKINVD 129 L +IL +L+ +LQ+VQK+ N D Sbjct: 1102 LNEILRELEARLQEVQKLLDNAD 1124 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 7.8 Identities = 23/73 (31%), Positives = 32/73 (43%) Frame = +1 Query: 232 RNFWLFRKIYAILAIGLLGFIV*AHHIFTVGIDIDTRAYFTSATIIIAVPTGIKIFR*LA 411 R F L Y A L F+V A T+GID+ A + ++ A+ T + I L Sbjct: 199 RGFILQPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT-VAIVPGLK 257 Query: 412 TIHGTQINYNPNI 450 TI G I N+ Sbjct: 258 TIVGAVIESVKNL 270 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 571,215 Number of Sequences: 2352 Number of extensions: 9625 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -