BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30911 (646 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 24 3.6 AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl c... 24 4.7 AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding pr... 23 6.3 AJ010904-1|CAA09390.1| 142|Anopheles gambiae nitric oxide synth... 23 8.3 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 24.2 bits (50), Expect = 3.6 Identities = 8/39 (20%), Positives = 20/39 (51%) Frame = +3 Query: 258 LTFQKITRIVTAVDSQPMFDGGVLINVLGRLKCDEDPPH 374 LT+ + I+ ++D+ P + + ++V+G + H Sbjct: 149 LTYHQFQAIIASMDAPPQPEAAITLDVIGNANTPQYDDH 187 >AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl cyclase beta subunit protein. Length = 649 Score = 23.8 bits (49), Expect = 4.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 118 VQQYYTLFDDPAQRANLVNMYNVET 192 + + YT+FD+ + N+Y VET Sbjct: 529 LNELYTIFDELTDSKSNSNIYKVET 553 >AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding protein AgamOBP33 protein. Length = 334 Score = 23.4 bits (48), Expect = 6.3 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +3 Query: 174 YVQC*NFIHDL*GSTTAGCC*NYGKIKSLTFQKITRIVTAVDSQPMFDGGVL--INVLGR 347 YVQC N+ ++ T G C Y ++KS Q + + ++GG+L I VLG Sbjct: 215 YVQCNNYANETRFRETTGTC--YRRLKS-ECQDECVLAGRFLRECFYEGGLLGSIPVLGG 271 Query: 348 L 350 L Sbjct: 272 L 272 >AJ010904-1|CAA09390.1| 142|Anopheles gambiae nitric oxide synthase protein. Length = 142 Score = 23.0 bits (47), Expect = 8.3 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +3 Query: 297 DSQPMFDGGVLINVLGRLKCDEDPPHLYMQTFVLK 401 + + M GVL V L +E+ P Y+Q LK Sbjct: 42 EKEEMVQKGVLDRVFLALSREENIPKTYVQDLALK 76 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 705,556 Number of Sequences: 2352 Number of extensions: 14951 Number of successful extensions: 30 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63559560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -