BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30909 (667 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC609.03 |||WD repeat protein, human IQWD1 family|Schizosaccha... 33 0.037 SPAC1687.09 |||conserved fungal protein|Schizosaccharomyces pomb... 29 0.80 SPBC336.04 |cdc6|pol3, pold, mis10|DNA polymerase delta catalyti... 27 2.4 SPCC1235.13 |ght6|meu12|hexose transporter Ght6 |Schizosaccharom... 26 4.2 SPBC1683.07 |mal1||alpha-glucosidase Mal1 |Schizosaccharomyces p... 25 7.4 SPAC19A8.02 |||transcriptional coactivator |Schizosaccharomyces ... 25 7.4 >SPBC609.03 |||WD repeat protein, human IQWD1 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 809 Score = 33.1 bits (72), Expect = 0.037 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 295 W*SFYDFLPWVVRLGIPSVVHAAYQIPPPSNLDAQGMTL 179 W YDF+ WV R + H A Q+ PP+N+ Q L Sbjct: 457 WGWLYDFMNWVTRYLLGISDHWALQMSPPTNVARQNFVL 495 >SPAC1687.09 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1379 Score = 28.7 bits (61), Expect = 0.80 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +3 Query: 297 RIPYGIP*ETALPIRRGSGRT*SQRASMTSCSRPPSNWQSYCDTHPP 437 ++PY + LPI SQ+ S S+ SN CD+HPP Sbjct: 519 QLPYFHQSSSELPISASKRAALSQQTE--SASKSSSNISEMCDSHPP 563 >SPBC336.04 |cdc6|pol3, pold, mis10|DNA polymerase delta catalytic subunit Cdc6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1086 Score = 27.1 bits (57), Expect = 2.4 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = -1 Query: 274 LPWVVRLGIPSVVHAAYQIPPPSNLDAQGMTLPYSILPTN*ALVPVYTRPDRFRRAD 104 LP ++LG + + + Q P P L+ + + PY ++ +TR D + + D Sbjct: 754 LPEAMKLGEEAANYVSDQFPNPIKLEFEKVYFPYLLISKKRYAGLFWTRTDTYDKMD 810 >SPCC1235.13 |ght6|meu12|hexose transporter Ght6 |Schizosaccharomyces pombe|chr 3|||Manual Length = 535 Score = 26.2 bits (55), Expect = 4.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 216 GIWYAACTTLGIPKRTTHGRKS*KLHHRIPYGI 314 GI+ AAC +G K TTH + R+P GI Sbjct: 158 GIFIAACINMGTHKYTTHP----EAQWRVPIGI 186 >SPBC1683.07 |mal1||alpha-glucosidase Mal1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 579 Score = 25.4 bits (53), Expect = 7.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +3 Query: 396 PPSNWQSYCDT 428 PP+NW+SY DT Sbjct: 149 PPNNWRSYFDT 159 >SPAC19A8.02 |||transcriptional coactivator |Schizosaccharomyces pombe|chr 1|||Manual Length = 1213 Score = 25.4 bits (53), Expect = 7.4 Identities = 10/52 (19%), Positives = 24/52 (46%) Frame = +2 Query: 137 NWNKRSICGENRVWECHALSVKVARRRYLVRGMYHTWNT*ADDPWKKIVEAS 292 N+++ C +C + V+ Y++ ++H+W D +K + + S Sbjct: 840 NYDQEGQCQSYHYEDCQIMDVRNDYHLYIMTWLHHSWTLPYRDYFKIVTKTS 891 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,528,124 Number of Sequences: 5004 Number of extensions: 50586 Number of successful extensions: 129 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 303841898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -