BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30906 (820 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 25 3.7 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 24 6.5 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 24.6 bits (51), Expect = 3.7 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = -2 Query: 555 YIPMCDVRFSFVIRLIESARSSQLNLSELST 463 ++P+C+ +S I ++SA + +L + LST Sbjct: 373 WVPICEPVYSNPINNMKSALTGELKICRLST 403 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 23.8 bits (49), Expect = 6.5 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 647 NGGCFCTAVASHSRNKRSVKNSQLSRTY 730 N G ++++S SRN S NS S T+ Sbjct: 36 NSGSPLSSISSSSRNSSSCNNSSSSGTH 63 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 867,618 Number of Sequences: 2352 Number of extensions: 16361 Number of successful extensions: 92 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86902827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -