BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30904X (563 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X69908-1|CAA49533.1| 141|Homo sapiens protein ( H.sapiens gene ... 64 4e-10 X69907-1|CAA49532.1| 136|Homo sapiens P1 gene for c subunit of ... 64 4e-10 U09813-1|AAA78807.1| 142|Homo sapiens mitochondrial ATP synthas... 64 4e-10 M16453-1|AAA51806.1| 100|Homo sapiens ATP5A protein. 64 4e-10 D13119-1|BAA02421.1| 141|Homo sapiens ATP synthase subunit c pr... 64 4e-10 D13118-1|BAA02420.1| 136|Homo sapiens ATP synthase subunit c pr... 64 4e-10 CR533449-1|CAG38480.1| 136|Homo sapiens ATP5G1 protein. 64 4e-10 CR407601-1|CAG28411.1| 142|Homo sapiens ATP5G3 protein. 64 4e-10 BT007230-1|AAP35894.1| 136|Homo sapiens ATP synthase, H+ transp... 64 4e-10 BC106881-1|AAI06882.1| 142|Homo sapiens ATP synthase, H+ transp... 64 4e-10 BC020826-1|AAH20826.1| 141|Homo sapiens ATP5G2 protein protein. 64 4e-10 BC004963-1|AAH04963.1| 136|Homo sapiens ATP synthase, H+ transp... 64 4e-10 AC096649-1|AAX88970.1| 142|Homo sapiens unknown protein. 64 4e-10 M16439-1|AAA51804.1| 58|Homo sapiens ATP5A protein. 62 1e-09 BC130578-1|AAI30579.1| 1935|Homo sapiens ADAM metallopeptidase w... 30 4.9 AL356104-4|CAH72941.1| 1037|Homo sapiens novel protein similar t... 30 4.9 AL158169-5|CAH70011.1| 1037|Homo sapiens novel protein similar t... 30 4.9 AK098809-1|BAC05419.1| 320|Homo sapiens protein ( Homo sapiens ... 30 4.9 AF488803-1|AAO15765.1| 1935|Homo sapiens a disintegrin-like and ... 30 4.9 AB037733-1|BAA92550.1| 1471|Homo sapiens KIAA1312 protein protein. 30 4.9 DQ012014-1|AAY59750.1| 62|Homo sapiens beta-defensin 110 protein. 30 6.5 BC062318-1|AAH62318.1| 559|Homo sapiens LAMA1 protein protein. 30 6.5 BC039051-1|AAH39051.1| 747|Homo sapiens LAMA1 protein protein. 30 6.5 AK000219-1|BAA91018.1| 420|Homo sapiens protein ( Homo sapiens ... 29 8.5 >X69908-1|CAA49533.1| 141|Homo sapiens protein ( H.sapiens gene for mitochondrial ATP synthase c subunit (P2 form). ). Length = 141 Score = 63.7 bits (148), Expect = 4e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 303 FGSLIIGYARNPSLKQQLFSYAILGFALSE 392 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 95 FGSLIIGYARNPSLKQQLFSYAILGFALSE 124 Score = 41.1 bits (92), Expect = 0.003 Identities = 17/28 (60%), Positives = 25/28 (89%) Frame = +1 Query: 172 TQLSAVRSFQTTSVTKDIDSAARFIGAG 255 T L + RSFQT+++++DID+AA+FIGAG Sbjct: 51 TSLVSSRSFQTSAISRDIDTAAKFIGAG 78 >X69907-1|CAA49532.1| 136|Homo sapiens P1 gene for c subunit of human mitochondrial ATP protein. Length = 136 Score = 63.7 bits (148), Expect = 4e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 303 FGSLIIGYARNPSLKQQLFSYAILGFALSE 392 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 90 FGSLIIGYARNPSLKQQLFSYAILGFALSE 119 Score = 41.9 bits (94), Expect = 0.001 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 7/58 (12%) Frame = +1 Query: 103 CNSALVRPLAAV----PTHTQMVPAV---PTQLSAVRSFQTTSVTKDIDSAARFIGAG 255 C L+RP++A P ++ P+ P Q+ A R FQT+ V++DID+AA+FIGAG Sbjct: 17 CTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQV-ARREFQTSVVSRDIDTAAKFIGAG 73 >U09813-1|AAA78807.1| 142|Homo sapiens mitochondrial ATP synthase subunit 9 precursor protein. Length = 142 Score = 63.7 bits (148), Expect = 4e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 303 FGSLIIGYARNPSLKQQLFSYAILGFALSE 392 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 96 FGSLIIGYARNPSLKQQLFSYAILGFALSE 125 Score = 37.1 bits (82), Expect = 0.043 Identities = 14/22 (63%), Positives = 21/22 (95%) Frame = +1 Query: 190 RSFQTTSVTKDIDSAARFIGAG 255 R FQT+++++DID+AA+FIGAG Sbjct: 58 REFQTSAISRDIDTAAKFIGAG 79 >M16453-1|AAA51806.1| 100|Homo sapiens ATP5A protein. Length = 100 Score = 63.7 bits (148), Expect = 4e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 303 FGSLIIGYARNPSLKQQLFSYAILGFALSE 392 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 54 FGSLIIGYARNPSLKQQLFSYAILGFALSE 83 Score = 37.1 bits (82), Expect = 0.043 Identities = 18/29 (62%), Positives = 24/29 (82%) Frame = +1 Query: 169 PTQLSAVRSFQTTSVTKDIDSAARFIGAG 255 P Q+ A R FQT+ V++DID+AA+FIGAG Sbjct: 10 PLQV-ARRGFQTSVVSRDIDTAAKFIGAG 37 >D13119-1|BAA02421.1| 141|Homo sapiens ATP synthase subunit c precursor protein. Length = 141 Score = 63.7 bits (148), Expect = 4e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 303 FGSLIIGYARNPSLKQQLFSYAILGFALSE 392 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 95 FGSLIIGYARNPSLKQQLFSYAILGFALSE 124 Score = 41.1 bits (92), Expect = 0.003 Identities = 17/28 (60%), Positives = 25/28 (89%) Frame = +1 Query: 172 TQLSAVRSFQTTSVTKDIDSAARFIGAG 255 T L + RSFQT+++++DID+AA+FIGAG Sbjct: 51 TSLVSSRSFQTSAISRDIDTAAKFIGAG 78 >D13118-1|BAA02420.1| 136|Homo sapiens ATP synthase subunit c precursor protein. Length = 136 Score = 63.7 bits (148), Expect = 4e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 303 FGSLIIGYARNPSLKQQLFSYAILGFALSE 392 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 90 FGSLIIGYARNPSLKQQLFSYAILGFALSE 119 Score = 41.9 bits (94), Expect = 0.001 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 7/58 (12%) Frame = +1 Query: 103 CNSALVRPLAAV----PTHTQMVPAV---PTQLSAVRSFQTTSVTKDIDSAARFIGAG 255 C L+RP++A P ++ P+ P Q+ A R FQT+ V++DID+AA+FIGAG Sbjct: 17 CTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQV-ARREFQTSVVSRDIDTAAKFIGAG 73 >CR533449-1|CAG38480.1| 136|Homo sapiens ATP5G1 protein. Length = 136 Score = 63.7 bits (148), Expect = 4e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 303 FGSLIIGYARNPSLKQQLFSYAILGFALSE 392 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 90 FGSLIIGYARNPSLKQQLFSYAILGFALSE 119 Score = 41.9 bits (94), Expect = 0.001 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 7/58 (12%) Frame = +1 Query: 103 CNSALVRPLAAV----PTHTQMVPAV---PTQLSAVRSFQTTSVTKDIDSAARFIGAG 255 C L+RP++A P ++ P+ P Q+ A R FQT+ V++DID+AA+FIGAG Sbjct: 17 CTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQV-ARREFQTSVVSRDIDTAAKFIGAG 73 >CR407601-1|CAG28411.1| 142|Homo sapiens ATP5G3 protein. Length = 142 Score = 63.7 bits (148), Expect = 4e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 303 FGSLIIGYARNPSLKQQLFSYAILGFALSE 392 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 96 FGSLIIGYARNPSLKQQLFSYAILGFALSE 125 Score = 37.1 bits (82), Expect = 0.043 Identities = 14/22 (63%), Positives = 21/22 (95%) Frame = +1 Query: 190 RSFQTTSVTKDIDSAARFIGAG 255 R FQT+++++DID+AA+FIGAG Sbjct: 58 REFQTSAISRDIDTAAKFIGAG 79 >BT007230-1|AAP35894.1| 136|Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), protein. Length = 136 Score = 63.7 bits (148), Expect = 4e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 303 FGSLIIGYARNPSLKQQLFSYAILGFALSE 392 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 90 FGSLIIGYARNPSLKQQLFSYAILGFALSE 119 Score = 41.9 bits (94), Expect = 0.001 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 7/58 (12%) Frame = +1 Query: 103 CNSALVRPLAAV----PTHTQMVPAV---PTQLSAVRSFQTTSVTKDIDSAARFIGAG 255 C L+RP++A P ++ P+ P Q+ A R FQT+ V++DID+AA+FIGAG Sbjct: 17 CTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQV-ARREFQTSVVSRDIDTAAKFIGAG 73 >BC106881-1|AAI06882.1| 142|Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) protein. Length = 142 Score = 63.7 bits (148), Expect = 4e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 303 FGSLIIGYARNPSLKQQLFSYAILGFALSE 392 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 96 FGSLIIGYARNPSLKQQLFSYAILGFALSE 125 Score = 37.1 bits (82), Expect = 0.043 Identities = 14/22 (63%), Positives = 21/22 (95%) Frame = +1 Query: 190 RSFQTTSVTKDIDSAARFIGAG 255 R FQT+++++DID+AA+FIGAG Sbjct: 58 REFQTSAISRDIDTAAKFIGAG 79 >BC020826-1|AAH20826.1| 141|Homo sapiens ATP5G2 protein protein. Length = 141 Score = 63.7 bits (148), Expect = 4e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 303 FGSLIIGYARNPSLKQQLFSYAILGFALSE 392 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 95 FGSLIIGYARNPSLKQQLFSYAILGFALSE 124 Score = 41.1 bits (92), Expect = 0.003 Identities = 17/28 (60%), Positives = 25/28 (89%) Frame = +1 Query: 172 TQLSAVRSFQTTSVTKDIDSAARFIGAG 255 T L + RSFQT+++++DID+AA+FIGAG Sbjct: 51 TSLVSSRSFQTSAISRDIDTAAKFIGAG 78 >BC004963-1|AAH04963.1| 136|Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) protein. Length = 136 Score = 63.7 bits (148), Expect = 4e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 303 FGSLIIGYARNPSLKQQLFSYAILGFALSE 392 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 90 FGSLIIGYARNPSLKQQLFSYAILGFALSE 119 Score = 41.9 bits (94), Expect = 0.001 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 7/58 (12%) Frame = +1 Query: 103 CNSALVRPLAAV----PTHTQMVPAV---PTQLSAVRSFQTTSVTKDIDSAARFIGAG 255 C L+RP++A P ++ P+ P Q+ A R FQT+ V++DID+AA+FIGAG Sbjct: 17 CTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQV-ARREFQTSVVSRDIDTAAKFIGAG 73 >AC096649-1|AAX88970.1| 142|Homo sapiens unknown protein. Length = 142 Score = 63.7 bits (148), Expect = 4e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 303 FGSLIIGYARNPSLKQQLFSYAILGFALSE 392 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 96 FGSLIIGYARNPSLKQQLFSYAILGFALSE 125 Score = 37.1 bits (82), Expect = 0.043 Identities = 14/22 (63%), Positives = 21/22 (95%) Frame = +1 Query: 190 RSFQTTSVTKDIDSAARFIGAG 255 R FQT+++++DID+AA+FIGAG Sbjct: 58 REFQTSAISRDIDTAAKFIGAG 79 >M16439-1|AAA51804.1| 58|Homo sapiens ATP5A protein. Length = 58 Score = 62.5 bits (145), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 303 FGSLIIGYARNPSLKQQLFSYAILGFALSE 392 FGSLIIGYARNPSLKQQLFSYAI+GFALSE Sbjct: 12 FGSLIIGYARNPSLKQQLFSYAIVGFALSE 41 >BC130578-1|AAI30579.1| 1935|Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 9 protein. Length = 1935 Score = 30.3 bits (65), Expect = 4.9 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -3 Query: 246 NESRSRVNVLSDRCGLEGPHCRELCRDSRYHLCMGGYCCKW 124 ++ R+ + D LE +C+ L + + C GG C KW Sbjct: 1461 HKQRNVYCMAKDGSHLESDYCKHLAKPHGHRKCRGGRCPKW 1501 >AL356104-4|CAH72941.1| 1037|Homo sapiens novel protein similar to mouse Jedi soluble isoform 736 protein protein. Length = 1037 Score = 30.3 bits (65), Expect = 4.9 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -3 Query: 204 GLEGPHCRELCRDSRYHLCMGGYCCKWSHQCRVAEDGRPGCRGDQ 70 G GP+C + CR GG C +++ QCR A PG GD+ Sbjct: 266 GFHGPNCSQECRCHN-----GGLCDRFTGQCRCA----PGYTGDR 301 >AL158169-5|CAH70011.1| 1037|Homo sapiens novel protein similar to mouse Jedi soluble isoform 736 protein protein. Length = 1037 Score = 30.3 bits (65), Expect = 4.9 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -3 Query: 204 GLEGPHCRELCRDSRYHLCMGGYCCKWSHQCRVAEDGRPGCRGDQ 70 G GP+C + CR GG C +++ QCR A PG GD+ Sbjct: 266 GFHGPNCSQECRCHN-----GGLCDRFTGQCRCA----PGYTGDR 301 >AK098809-1|BAC05419.1| 320|Homo sapiens protein ( Homo sapiens cDNA FLJ25943 fis, clone JTH10559. ). Length = 320 Score = 30.3 bits (65), Expect = 4.9 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -3 Query: 204 GLEGPHCRELCRDSRYHLCMGGYCCKWSHQCRVAEDGRPGCRGDQ 70 G GP+C + CR GG C +++ QCR A PG GD+ Sbjct: 67 GFHGPNCSQECRCHN-----GGLCDRFTGQCRCA----PGYTGDR 102 >AF488803-1|AAO15765.1| 1935|Homo sapiens a disintegrin-like and metalloprotease with thrombospondin type 1 motifs 9B protein. Length = 1935 Score = 30.3 bits (65), Expect = 4.9 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -3 Query: 246 NESRSRVNVLSDRCGLEGPHCRELCRDSRYHLCMGGYCCKW 124 ++ R+ + D LE +C+ L + + C GG C KW Sbjct: 1461 HKQRNVYCMAKDGSHLESDYCKHLAKPHGHRKCRGGRCPKW 1501 >AB037733-1|BAA92550.1| 1471|Homo sapiens KIAA1312 protein protein. Length = 1471 Score = 30.3 bits (65), Expect = 4.9 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -3 Query: 246 NESRSRVNVLSDRCGLEGPHCRELCRDSRYHLCMGGYCCKW 124 ++ R+ + D LE +C+ L + + C GG C KW Sbjct: 1303 HKQRNVYCMAKDGSHLESDYCKHLAKPHGHRKCRGGRCPKW 1343 >DQ012014-1|AAY59750.1| 62|Homo sapiens beta-defensin 110 protein. Length = 62 Score = 29.9 bits (64), Expect = 6.5 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -3 Query: 213 DRCGLEGPHCRELCRDSRYHLCMGGYCCKWSHQCRV 106 +RC C+ C D Y GYC KW QC V Sbjct: 30 ERCEKVRGICKTFCDDVEYDY---GYCIKWRSQCCV 62 >BC062318-1|AAH62318.1| 559|Homo sapiens LAMA1 protein protein. Length = 559 Score = 29.9 bits (64), Expect = 6.5 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = -3 Query: 246 NESRSRVNVLSD--RCGLEGPHCRELCRDSRYHLCMGGYCCKWSHQCRVAEDGRPGC 82 N+S+ R+ ++ D G E PH + D+ + +GGY +C ++ GC Sbjct: 467 NKSKHRITLIVDGNAVGAESPHTQSTSVDTNNPIYVGGYPAGVKQKCLRSQTSFRGC 523 >BC039051-1|AAH39051.1| 747|Homo sapiens LAMA1 protein protein. Length = 747 Score = 29.9 bits (64), Expect = 6.5 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = -3 Query: 246 NESRSRVNVLSD--RCGLEGPHCRELCRDSRYHLCMGGYCCKWSHQCRVAEDGRPGC 82 N+S+ R+ ++ D G E PH + D+ + +GGY +C ++ GC Sbjct: 655 NKSKHRITLIVDGNAVGAESPHTQSTSVDTNNPIYVGGYPAGVKQKCLRSQTSFRGC 711 >AK000219-1|BAA91018.1| 420|Homo sapiens protein ( Homo sapiens cDNA FLJ20212 fis, clone COLF1860. ). Length = 420 Score = 29.5 bits (63), Expect = 8.5 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -1 Query: 263 CRCPAPMNLAAESMSLVTDVVWKDRTAESCVG 168 CRC A + + +L+ + +W T CVG Sbjct: 349 CRCSAEPDFSQNKQTLLVEFLWSHTTESMCVG 380 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,280,890 Number of Sequences: 237096 Number of extensions: 1947759 Number of successful extensions: 9829 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 9334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9824 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5703349406 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -