BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30901 (788 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 25 0.52 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 24 1.6 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 23 2.1 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 3.7 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 3.7 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 3.7 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 3.7 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 3.7 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 3.7 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 3.7 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 3.7 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 3.7 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 25.4 bits (53), Expect = 0.52 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 278 ASCTPPALTPPHRPRTSATVPPA 346 A T P LTPPH P S PP+ Sbjct: 12 ADSTSPLLTPPHNPAYSP--PPS 32 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -3 Query: 414 CSVYSSQYMVKNGVDDAVDIYSGAGGTVAD 325 C Y + V VD+ +YSG G V + Sbjct: 253 CQYYQGKNCVGGKVDETAGVYSGWEGQVLE 282 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 Query: 305 PPHRPRTSATVPP 343 P +RPRTS T PP Sbjct: 231 PYYRPRTSRTEPP 243 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 248 EDVQWNSGCVASCTPPALTPPHRPRTSATVPPAPL*MSTA 367 +D+ N G TPP TP + T ++ +PL +ST+ Sbjct: 114 QDLSTN-GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 152 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 248 EDVQWNSGCVASCTPPALTPPHRPRTSATVPPAPL*MSTA 367 +D+ N G TPP TP + T ++ +PL +ST+ Sbjct: 114 QDLSTN-GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 152 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 248 EDVQWNSGCVASCTPPALTPPHRPRTSATVPPAPL*MSTA 367 +D+ N G TPP TP + T ++ +PL +ST+ Sbjct: 114 QDLSTN-GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 152 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 248 EDVQWNSGCVASCTPPALTPPHRPRTSATVPPAPL*MSTA 367 +D+ N G TPP TP + T ++ +PL +ST+ Sbjct: 114 QDLSTN-GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 152 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 248 EDVQWNSGCVASCTPPALTPPHRPRTSATVPPAPL*MSTA 367 +D+ N G TPP TP + T ++ +PL +ST+ Sbjct: 114 QDLSTN-GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 152 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 248 EDVQWNSGCVASCTPPALTPPHRPRTSATVPPAPL*MSTA 367 +D+ N G TPP TP + T ++ +PL +ST+ Sbjct: 70 QDLSTN-GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 108 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 248 EDVQWNSGCVASCTPPALTPPHRPRTSATVPPAPL*MSTA 367 +D+ N G TPP TP + T ++ +PL +ST+ Sbjct: 114 QDLSTN-GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 152 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 248 EDVQWNSGCVASCTPPALTPPHRPRTSATVPPAPL*MSTA 367 +D+ N G TPP TP + T ++ +PL +ST+ Sbjct: 114 QDLSTN-GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 152 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 248 EDVQWNSGCVASCTPPALTPPHRPRTSATVPPAPL*MSTA 367 +D+ N G TPP TP + T ++ +PL +ST+ Sbjct: 114 QDLSTN-GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 152 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,462 Number of Sequences: 336 Number of extensions: 3826 Number of successful extensions: 21 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21376414 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -