BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30896 (502 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g18510.1 68414.m02310 hypothetical protein 28 3.1 At1g31130.1 68414.m03809 expressed protein 27 9.4 >At1g18510.1 68414.m02310 hypothetical protein Length = 238 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 248 IFSILFIRMILVIINMGGYNLRFFFY 325 +F+I MI V I +GGY+L+ F Y Sbjct: 60 MFTIYIYAMIFVSIVLGGYSLKCFIY 85 >At1g31130.1 68414.m03809 expressed protein Length = 321 Score = 26.6 bits (56), Expect = 9.4 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 248 IFSILFIRMILVIINMGGYNLRFFFYLKLRLIS 346 +F LFI + V + M YN FF +L + L++ Sbjct: 125 VFKRLFITFLWVALLMFAYNAVFFVFLVMLLVA 157 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,630,351 Number of Sequences: 28952 Number of extensions: 63235 Number of successful extensions: 135 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 135 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 888318720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -