BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30892 (468 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding pr... 27 0.33 AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding pr... 27 0.33 AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding pr... 27 0.33 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 26 0.75 AF387858-1|AAL58708.1| 209|Anopheles gambiae integrase protein. 26 0.75 AF387857-1|AAL58707.1| 215|Anopheles gambiae integrase protein. 26 0.75 AF387850-1|AAL58705.1| 209|Anopheles gambiae integrase protein. 26 0.75 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 24 2.3 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 7.0 >AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding protein AgamOBP30 protein. Length = 289 Score = 27.1 bits (57), Expect = 0.33 Identities = 17/65 (26%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Frame = +2 Query: 197 IGVYKKTSNIRERRLARY-HPE---ADASRRL*KC*KSFAADLPVPSKIKCCVIFDGFVF 364 +G + T ++E + + HP+ D RR +C S D P P C ++ F Sbjct: 94 LGWWNDTHGVQEASMRSFFHPDPNDCDYERRTYRCLHSQRLDRPAPHDEACERAYESFRC 153 Query: 365 LYLHW 379 Y H+ Sbjct: 154 YYEHY 158 >AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding protein OBPjj83c protein. Length = 273 Score = 27.1 bits (57), Expect = 0.33 Identities = 17/65 (26%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Frame = +2 Query: 197 IGVYKKTSNIRERRLARY-HPE---ADASRRL*KC*KSFAADLPVPSKIKCCVIFDGFVF 364 +G + T ++E + + HP+ D RR +C S D P P C ++ F Sbjct: 78 LGWWNDTHGVQEASMRSFFHPDPNDCDYERRTYRCLHSQRLDRPAPHDEACERAYESFRC 137 Query: 365 LYLHW 379 Y H+ Sbjct: 138 YYEHY 142 >AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding protein 1 protein. Length = 289 Score = 27.1 bits (57), Expect = 0.33 Identities = 17/65 (26%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Frame = +2 Query: 197 IGVYKKTSNIRERRLARY-HPE---ADASRRL*KC*KSFAADLPVPSKIKCCVIFDGFVF 364 +G + T ++E + + HP+ D RR +C S D P P C ++ F Sbjct: 94 LGWWNDTHGVQEASMRSFFHPDPNDCDYERRTYRCLHSQRLDRPAPHDEACERAYESFRC 153 Query: 365 LYLHW 379 Y H+ Sbjct: 154 YYEHY 158 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 25.8 bits (54), Expect = 0.75 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +2 Query: 5 FDDAIAE-LDTLNEDSYKDSTLIMQLLRD-NLTLWTSDTQGDGDE 133 FDD + + L++ EDS D TLI + L D + ++ S + DGD+ Sbjct: 334 FDDDVGDRLESEEEDS-TDETLIEEELTDTDSSMCDSTNEDDGDD 377 >AF387858-1|AAL58708.1| 209|Anopheles gambiae integrase protein. Length = 209 Score = 25.8 bits (54), Expect = 0.75 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +2 Query: 5 FDDAIAE-LDTLNEDSYKDSTLIMQLLRD-NLTLWTSDTQGDGDE 133 FDD + + L++ EDS D TLI + L D + ++ S + DGD+ Sbjct: 104 FDDDVGDRLESEEEDS-TDETLIEEELTDTDSSMCDSTNEDDGDD 147 >AF387857-1|AAL58707.1| 215|Anopheles gambiae integrase protein. Length = 215 Score = 25.8 bits (54), Expect = 0.75 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +2 Query: 5 FDDAIAE-LDTLNEDSYKDSTLIMQLLRD-NLTLWTSDTQGDGDE 133 FDD + + L++ EDS D TLI + L D + ++ S + DGD+ Sbjct: 110 FDDDVGDRLESEEEDS-TDETLIEEELTDTDSSMCDSTNEDDGDD 153 >AF387850-1|AAL58705.1| 209|Anopheles gambiae integrase protein. Length = 209 Score = 25.8 bits (54), Expect = 0.75 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +2 Query: 5 FDDAIAE-LDTLNEDSYKDSTLIMQLLRD-NLTLWTSDTQGDGDE 133 FDD + + L++ EDS D TLI + L D + ++ S + DGD+ Sbjct: 104 FDDDVGDRLESEEEDS-TDETLIEEELTDTDSSMCDSTNEDDGDD 147 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 24.2 bits (50), Expect = 2.3 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +2 Query: 47 SYKDSTLIMQLLRDNLTLWTSDTQGDGDEPAEGGDN*YLAALTPAHAF 190 SY+ I+ ++ + LW + GD A GG L LT A F Sbjct: 145 SYRQFARILSIILIGVLLWITAFVIIGDTAAPGGQLFQLVVLTVAANF 192 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 22.6 bits (46), Expect = 7.0 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -3 Query: 160 ILVVAALGRLVAIALSV*RPKRQVISQQLHY*RRIFVRIF 41 ++ + L L V P+R ++ L+Y RIF IF Sbjct: 1311 VITMILLSSLALALEDVHLPQRPILQDILYYMDRIFTVIF 1350 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 386,842 Number of Sequences: 2352 Number of extensions: 6373 Number of successful extensions: 15 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40820256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -