BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30890X (369 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0451 + 3194919-3195416,3195560-3195580,3196282-3196467,319... 28 2.0 02_05_0469 + 29297209-29297527,29297847-29297961,29298060-292982... 27 3.5 >06_01_0451 + 3194919-3195416,3195560-3195580,3196282-3196467, 3197272-3197556 Length = 329 Score = 28.3 bits (60), Expect = 2.0 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = -2 Query: 185 FDSGT*LSHSGILNILITIQLSIKNTVFSPSVQTFARYTLNAVRRCFNESS 33 F +G HSG+ L+T+ S+ V++P+ T +R ++E S Sbjct: 180 FYAGEGTDHSGVPTKLVTLNCSLHIAVYNPASMFGIHVTTGPIRLLYSEIS 230 >02_05_0469 + 29297209-29297527,29297847-29297961,29298060-29298255, 29298427-29298540,29298695-29298868,29299326-29299520, 29299666-29299788,29299892-29300004,29300117-29300237, 29300363-29300623,29301712-29301921 Length = 646 Score = 27.5 bits (58), Expect = 3.5 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 148 KIPEWDSYVPESNIKFSRKTVKAKSQNLILKTET 249 ++ E+ S V E N KF+ K QNL L ET Sbjct: 506 RMDEFTSRVEELNCKFAIKKSSTSQQNLALPNET 539 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,784,347 Number of Sequences: 37544 Number of extensions: 135724 Number of successful extensions: 216 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 216 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 576724416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -