BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30890X (369 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578804-1|AAT07309.1| 133|Anopheles gambiae maverick protein. 23 4.8 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 22 6.4 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 22 8.4 >AY578804-1|AAT07309.1| 133|Anopheles gambiae maverick protein. Length = 133 Score = 22.6 bits (46), Expect = 4.8 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -1 Query: 219 FCLDGFPTEFNI*FRHITIPFRYFEHFNYN 130 FC PT+FN H + EH Y+ Sbjct: 61 FCRGRCPTKFNPATHHALLQSLLHEHIKYD 90 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 22.2 bits (45), Expect = 6.4 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +1 Query: 97 GENTVFLIES*IVIKMFKIPEWDSYV 174 G T+FL+ ++ +F+I W S++ Sbjct: 582 GPGTIFLMMVGALVAVFRIDIWTSFL 607 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 21.8 bits (44), Expect = 8.4 Identities = 5/15 (33%), Positives = 10/15 (66%) Frame = -1 Query: 303 LHLHFLETAWCWLIE 259 L + ++ + WCW +E Sbjct: 514 LFVRYMNSCWCWDLE 528 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 339,781 Number of Sequences: 2352 Number of extensions: 7972 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 27944475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -