BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30881 (714 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 25 2.4 AF513637-1|AAM53609.1| 214|Anopheles gambiae glutathione S-tran... 25 3.1 Z81292-1|CAB03593.1| 209|Anopheles gambiae GSTD1-6 protein prot... 23 9.5 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 9.5 AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-tran... 23 9.5 AF071162-1|AAC79998.1| 216|Anopheles gambiae glutathione S-tran... 23 9.5 AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-tran... 23 9.5 AF071160-2|AAC79994.1| 216|Anopheles gambiae glutathione S-tran... 23 9.5 AF071160-1|AAC79995.1| 209|Anopheles gambiae glutathione S-tran... 23 9.5 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 25.0 bits (52), Expect = 2.4 Identities = 13/56 (23%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = +1 Query: 532 ILY*TNSKVSSXXXXXXXXXXTVAILQIT*NKVKKVYQDKF---RSRKRMMIQGNK 690 +LY +S + + + IL + N ++K+Y +F S + + +QGN+ Sbjct: 855 VLYANHSNIEAIYNTTFIGLRRLTILHLENNAIRKLYGHEFSALESLRELYLQGNR 910 >AF513637-1|AAM53609.1| 214|Anopheles gambiae glutathione S-transferase D11 protein. Length = 214 Score = 24.6 bits (51), Expect = 3.1 Identities = 19/80 (23%), Positives = 36/80 (45%), Gaps = 2/80 (2%) Frame = +1 Query: 307 MPLSFFQPTTPTRLINWTKSMGINLKATDSICQFHFKEEHIKMYDKIKIGEVIYFSYLL- 483 +PLS P RL+ + +NLK D + H K E +K+ + + ++ ++L Sbjct: 6 LPLS--APCQSIRLLAKALGLHLNLKEVDLLKGEHLKPEFLKINPQHTVPTLVDNDFVLW 63 Query: 484 -KKVLKEEACQQLSINFILY 540 + + C++ N LY Sbjct: 64 ESRAILTYLCEKYGKNDGLY 83 >Z81292-1|CAB03593.1| 209|Anopheles gambiae GSTD1-6 protein protein. Length = 209 Score = 23.0 bits (47), Expect = 9.5 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +1 Query: 307 MPLSFFQPTTPTRLINWTKS---MGINLKATDSICQFHFKEEHIKM 435 M + + P R + T + + +NLK TD + H K E +K+ Sbjct: 1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKL 46 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 265 SSPQNFDHSGK 233 +SP NFDH GK Sbjct: 1491 NSPMNFDHVGK 1501 >AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-transferase D1-3 protein. Length = 218 Score = 23.0 bits (47), Expect = 9.5 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +1 Query: 307 MPLSFFQPTTPTRLINWTKS---MGINLKATDSICQFHFKEEHIKM 435 M + + P R + T + + +NLK TD + H K E +K+ Sbjct: 1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKL 46 >AF071162-1|AAC79998.1| 216|Anopheles gambiae glutathione S-transferase D1-4 protein. Length = 216 Score = 23.0 bits (47), Expect = 9.5 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +1 Query: 307 MPLSFFQPTTPTRLINWTKS---MGINLKATDSICQFHFKEEHIKM 435 M + + P R + T + + +NLK TD + H K E +K+ Sbjct: 1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKL 46 >AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-transferase protein. Length = 218 Score = 23.0 bits (47), Expect = 9.5 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +1 Query: 307 MPLSFFQPTTPTRLINWTKS---MGINLKATDSICQFHFKEEHIKM 435 M + + P R + T + + +NLK TD + H K E +K+ Sbjct: 1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKL 46 >AF071160-2|AAC79994.1| 216|Anopheles gambiae glutathione S-transferase protein. Length = 216 Score = 23.0 bits (47), Expect = 9.5 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +1 Query: 307 MPLSFFQPTTPTRLINWTKS---MGINLKATDSICQFHFKEEHIKM 435 M + + P R + T + + +NLK TD + H K E +K+ Sbjct: 1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKL 46 >AF071160-1|AAC79995.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 23.0 bits (47), Expect = 9.5 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +1 Query: 307 MPLSFFQPTTPTRLINWTKS---MGINLKATDSICQFHFKEEHIKM 435 M + + P R + T + + +NLK TD + H K E +K+ Sbjct: 1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKL 46 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 592,947 Number of Sequences: 2352 Number of extensions: 11649 Number of successful extensions: 26 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -