BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30881 (714 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 6.6 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 22 6.6 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 21 8.8 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 21 8.8 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 21 8.8 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 21 8.8 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 Query: 277 GRTGKKKNNRMPLSFFQP 330 GRTG+ N SFF P Sbjct: 540 GRTGRVGNRGRATSFFDP 557 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.8 bits (44), Expect = 6.6 Identities = 12/46 (26%), Positives = 21/46 (45%) Frame = +3 Query: 543 DQQQSILKVQELLIDPQNSCYSTDYIEQSQESLPGQVQIEKTHDDS 680 D IL +L+ + + + +E + G +IEK+ DDS Sbjct: 23 DNSVHILSKYQLITSTTLNWLPRTHYDHLKEIVIGGFEIEKSEDDS 68 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 21.4 bits (43), Expect = 8.8 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = +2 Query: 104 IDGLTCLLIV*FLMYSDIHCNLNY 175 I G TC + + + + D HC++ + Sbjct: 106 IFGSTCKIDIAWFPFDDQHCDMKF 129 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -2 Query: 194 WDWYYMCSLNYSEYHYTLKIRQSVNKL 114 WD+YY+ +E Y L + N + Sbjct: 172 WDYYYIYHTLVAEQSYGLTLPSWTNNI 198 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -2 Query: 194 WDWYYMCSLNYSEYHYTLKIRQSVNKL 114 WD+YY+ +E Y L + N + Sbjct: 187 WDYYYIYHTLVAEQSYGLTLPSWTNNI 213 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -2 Query: 194 WDWYYMCSLNYSEYHYTLKIRQSVNKL 114 WD+YY+ +E Y L + N + Sbjct: 75 WDYYYIYHTLVAEQSYGLTLPSWTNNI 101 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,553 Number of Sequences: 438 Number of extensions: 2876 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -