BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30878 (734 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 25 0.56 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 24 1.7 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 2.3 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 3.0 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 3.0 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 22 5.2 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 22 5.2 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 21 9.1 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 21 9.1 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 25.4 bits (53), Expect = 0.56 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = -2 Query: 385 LPSTSILLVANSTPMVDLDSKLNSFLVKRDRRLLLPTPESPMSTL*TNNHI 233 LPS L NS L SKL + VK+D+ ++L P+ +L T ++ Sbjct: 675 LPSLPSTLTKNSKQ--GLFSKLFAKKVKKDKDIILNVPKESTQSLTTTGNV 723 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 63 NHN*KVMLKEPCIVL*ICDICVQYY 137 +H KV+ K P I C+I V+Y+ Sbjct: 128 HHTGKVVWKPPAIYKSFCEIDVEYF 152 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 499 PVVQNVERWLRELRDHADQNILIMLV 576 P+++ +E W+ L + +NIL MLV Sbjct: 494 PLIELIEHWMPLLPNWILENILDMLV 519 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.0 bits (47), Expect = 3.0 Identities = 8/19 (42%), Positives = 11/19 (57%), Gaps = 1/19 (5%) Frame = +3 Query: 450 YYRGAWAR-CWFTTSPSTC 503 YY W + CW T+P+ C Sbjct: 485 YYPCCWWKICWTITTPAIC 503 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.0 bits (47), Expect = 3.0 Identities = 8/19 (42%), Positives = 11/19 (57%), Gaps = 1/19 (5%) Frame = +3 Query: 450 YYRGAWAR-CWFTTSPSTC 503 YY W + CW T+P+ C Sbjct: 538 YYPCCWWKICWTITTPAIC 556 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 118 IFVSNIIFIYGHLDVSKLTD 177 IF+ IIFIY + ++++TD Sbjct: 13 IFLILIIFIYSNETIAQVTD 32 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 118 IFVSNIIFIYGHLDVSKLTD 177 IF+ IIFIY + ++++TD Sbjct: 13 IFLILIIFIYSNETIAQVTD 32 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = -3 Query: 567 DEDVLVGVVAQLAQPSLHVLYDRCLAMS 484 DED+++G++ Q + +CL S Sbjct: 91 DEDIMLGLLPDQLQERAQSVMGKCLPTS 118 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = -3 Query: 567 DEDVLVGVVAQLAQPSLHVLYDRCLAMS 484 DED+++G++ Q + +CL S Sbjct: 91 DEDIMLGLLPDQLQERAQSVMGKCLPTS 118 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,300 Number of Sequences: 438 Number of extensions: 3737 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -