BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30876 (762 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0085 + 14725531-14726622 29 5.3 05_07_0003 + 26981956-26982190,26982258-26982318,26982739-269828... 28 9.3 >10_08_0085 + 14725531-14726622 Length = 363 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +3 Query: 444 LVCLFKYRYYLYVITVYNSLNISFTYVCDSSVICLFSFAGS 566 L+C K Y+ V TV N L ++ + CD FSF GS Sbjct: 285 LICEEKLCKYIGVCTVSNILALADQHHCDGLKKACFSFLGS 325 >05_07_0003 + 26981956-26982190,26982258-26982318,26982739-26982833, 26983304-26983479,26983738-26983959,26984041-26984279, 26984786-26985311,26985407-26985680,26985759-26986410, 26986508-26986736,26986841-26987107,26987180-26987443, 26987526-26988194 Length = 1302 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/46 (26%), Positives = 25/46 (54%) Frame = +3 Query: 90 TNYHSIVLNNVKILALHTVIRVARFIVYPVFNWRSILIVCIAISPG 227 +N +V +++ ++ +V +A FI+ V NWR L+ + + G Sbjct: 839 SNIRRLVGDSLALIVRSSVTIIAGFIIAMVANWRLALVATVVLPLG 884 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,950,005 Number of Sequences: 37544 Number of extensions: 279097 Number of successful extensions: 517 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2039640244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -