BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30876 (762 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precu... 28 0.36 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 2.5 >AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precursor protein. Length = 267 Score = 27.9 bits (59), Expect = 0.36 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = -3 Query: 721 LVTALITDYIIGGCVLTHGSNDRKCRRKTIFGDELQRSDAHN 596 L T L+ +I GG + + R RR+ +FG D H+ Sbjct: 50 LATRLLRYFIFGGIIQAISAETRIPRRRLVFGGRSMFQDKHS 91 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 25.0 bits (52), Expect = 2.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 643 GDTYDRLSRASGHSRRLYNL*LVRSPK 723 G+T+D L AS RRL L + +S K Sbjct: 802 GETFDELPTASARPRRLSELSVKKSKK 828 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 680,364 Number of Sequences: 2352 Number of extensions: 12735 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -