BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30875X (352 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-8|CAJ14149.1| 247|Anopheles gambiae putative signal pe... 22 7.6 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 22 7.6 >CR954256-8|CAJ14149.1| 247|Anopheles gambiae putative signal peptidase protein. Length = 247 Score = 21.8 bits (44), Expect = 7.6 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -2 Query: 351 HAEYQTELTDAVYFYAWIFNNDISESCQSMRYG 253 H E +T + + WI +++ S S YG Sbjct: 190 HPEPRTSIVIVPRGHLWIEGDNVQNSSDSRNYG 222 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 21.8 bits (44), Expect = 7.6 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 191 LDLLKFVREEVKGDMTMER 247 LD++ ++ EEVK ++ ER Sbjct: 898 LDIVHYILEEVKEELGRER 916 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 348,886 Number of Sequences: 2352 Number of extensions: 6746 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 25364985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -