BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30873 (724 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 25 0.62 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 1.9 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 3.3 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 3.3 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 4.4 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 22 5.8 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 22 5.8 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.6 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 25.0 bits (52), Expect = 0.62 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +3 Query: 507 GKLV*QVKVDFQERLEHHALVK 572 G++V + +VD +ERLE+H VK Sbjct: 862 GEVVVKKEVDEEERLENHTSVK 883 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/39 (28%), Positives = 23/39 (58%), Gaps = 4/39 (10%) Frame = -1 Query: 160 LSHQVIL----VYLRDLDHLFALVHQTQWPPSLLDLLFP 56 ++H+V+ +Y+ +++H F++ Q L D+LFP Sbjct: 329 INHRVVFTAMGLYVLNMEHFFSVKCSIQSESLLNDILFP 367 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -3 Query: 137 IPEGP*SPFCPGAPNPVAPFSPR 69 IP+ P C P PV P P+ Sbjct: 994 IPDNPSREDCTKPPEPVTPAPPQ 1016 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 22.6 bits (46), Expect = 3.3 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +3 Query: 585 EFYWYDTVKEKSSHNVNPVTSNYGMDILYCT*M 683 + Y T SS+ ++P+T Y M+ + C M Sbjct: 5 KLYSDSTTMATSSNAMSPMTPTYSMNSMSCVSM 37 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/26 (34%), Positives = 9/26 (34%) Frame = -3 Query: 347 TTRSWFSFCAVHEFCRLAFITFHPXF 270 T F C H FC T H F Sbjct: 157 TVHLLFLLCIYHFFCAFIIFTMHLLF 182 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 21.8 bits (44), Expect = 5.8 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = -1 Query: 559 WCSRRSWKS 533 WC RR W S Sbjct: 119 WCPRREWSS 127 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.8 bits (44), Expect = 5.8 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = -1 Query: 559 WCSRRSWKS 533 WC RR W S Sbjct: 275 WCPRREWSS 283 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -3 Query: 698 GLFRCHLCT 672 GLF+C LCT Sbjct: 1115 GLFKCMLCT 1123 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -3 Query: 698 GLFRCHLCT 672 GLF+C LCT Sbjct: 1115 GLFKCMLCT 1123 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -3 Query: 698 GLFRCHLCT 672 GLF+C LCT Sbjct: 1115 GLFKCMLCT 1123 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -3 Query: 698 GLFRCHLCT 672 GLF+C LCT Sbjct: 1115 GLFKCMLCT 1123 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,099 Number of Sequences: 336 Number of extensions: 3629 Number of successful extensions: 14 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19259425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -