BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30865 (675 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondria... 122 3e-28 At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial,... 122 3e-28 At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondria... 122 3e-28 At2g07698.1 68415.m00949 ATP synthase alpha chain, mitochondrial... 32 0.40 At3g16860.1 68416.m02156 phytochelatin synthetase-related contai... 30 1.6 At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putati... 29 2.8 At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putati... 29 2.8 At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATP... 29 2.8 At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putati... 29 2.8 At1g20260.1 68414.m02529 vacuolar ATP synthase subunit B, putati... 29 2.8 At3g42820.1 68416.m04484 hypothetical protein hypothetical prote... 29 3.8 At1g50790.1 68414.m05712 hypothetical protein 29 3.8 At3g59010.1 68416.m06577 pectinesterase family protein contains ... 28 6.6 At3g11340.1 68416.m01379 UDP-glucoronosyl/UDP-glucosyl transfera... 27 8.7 At1g76550.1 68414.m08908 pyrophosphate--fructose-6-phosphate 1-p... 27 8.7 At1g28380.1 68414.m03487 expressed protein 27 8.7 At1g04150.1 68414.m00405 C2 domain-containing protein contains I... 27 8.7 >At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondrial identical to SP|P83484 ATP synthase beta chain 2, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452187|dbj|AK118582.1| Length = 556 Score = 122 bits (293), Expect = 3e-28 Identities = 58/86 (67%), Positives = 72/86 (83%), Gaps = 2/86 (2%) Frame = +1 Query: 256 IGAVVDVQFEDN--LPPILNALEVQNRSPRLXLEVAQHLGENTVRTIAMDGTEGLVRGQP 429 IGA+VDV+FED LPPI+ +LEVQ+ RL LEV+ HLG+N VRTIAMDGTEGLVRG+ Sbjct: 90 IGAIVDVRFEDQEGLPPIMTSLEVQDHPTRLVLEVSHHLGQNVVRTIAMDGTEGLVRGRK 149 Query: 430 VLDSGSPIRIPVGAETLGRIINVIGE 507 VL++G+PI +PVG TLGRI+NV+GE Sbjct: 150 VLNTGAPITVPVGRATLGRIMNVLGE 175 Score = 77.8 bits (183), Expect = 6e-15 Identities = 36/55 (65%), Positives = 42/55 (76%) Frame = +3 Query: 510 IDERGPIPTDKTAAIHAEAPEFVDMSVQQEILVTGIRVVDLLAPYAKGGKIGLFG 674 IDERG I T+ IH +AP VD++ QEIL TGI+VVDLLAPY +GGKIGLFG Sbjct: 177 IDERGEIKTEHYLPIHRDAPALVDLATGQEILATGIKVVDLLAPYQRGGKIGLFG 231 >At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial, putative strong similarity to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}, SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 559 Score = 122 bits (293), Expect = 3e-28 Identities = 58/86 (67%), Positives = 72/86 (83%), Gaps = 2/86 (2%) Frame = +1 Query: 256 IGAVVDVQFEDN--LPPILNALEVQNRSPRLXLEVAQHLGENTVRTIAMDGTEGLVRGQP 429 IGA+VDV+FED LPPI+ +LEVQ+ RL LEV+ HLG+N VRTIAMDGTEGLVRG+ Sbjct: 93 IGAIVDVRFEDQEGLPPIMTSLEVQDHPTRLVLEVSHHLGQNVVRTIAMDGTEGLVRGRK 152 Query: 430 VLDSGSPIRIPVGAETLGRIINVIGE 507 VL++G+PI +PVG TLGRI+NV+GE Sbjct: 153 VLNTGAPITVPVGRATLGRIMNVLGE 178 Score = 77.8 bits (183), Expect = 6e-15 Identities = 36/55 (65%), Positives = 42/55 (76%) Frame = +3 Query: 510 IDERGPIPTDKTAAIHAEAPEFVDMSVQQEILVTGIRVVDLLAPYAKGGKIGLFG 674 IDERG I T+ IH +AP VD++ QEIL TGI+VVDLLAPY +GGKIGLFG Sbjct: 180 IDERGEIKTEHYLPIHRDAPALVDLATGQEILATGIKVVDLLAPYQRGGKIGLFG 234 >At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondrial identical to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452102|dbj|AK118538.1| Length = 556 Score = 122 bits (293), Expect = 3e-28 Identities = 58/86 (67%), Positives = 72/86 (83%), Gaps = 2/86 (2%) Frame = +1 Query: 256 IGAVVDVQFEDN--LPPILNALEVQNRSPRLXLEVAQHLGENTVRTIAMDGTEGLVRGQP 429 IGA+VDV+FED LPPI+ +LEVQ+ RL LEV+ HLG+N VRTIAMDGTEGLVRG+ Sbjct: 90 IGAIVDVRFEDQEGLPPIMTSLEVQDHPTRLVLEVSHHLGQNVVRTIAMDGTEGLVRGRK 149 Query: 430 VLDSGSPIRIPVGAETLGRIINVIGE 507 VL++G+PI +PVG TLGRI+NV+GE Sbjct: 150 VLNTGAPITVPVGRATLGRIMNVLGE 175 Score = 77.8 bits (183), Expect = 6e-15 Identities = 36/55 (65%), Positives = 42/55 (76%) Frame = +3 Query: 510 IDERGPIPTDKTAAIHAEAPEFVDMSVQQEILVTGIRVVDLLAPYAKGGKIGLFG 674 IDERG I T+ IH +AP VD++ QEIL TGI+VVDLLAPY +GGKIGLFG Sbjct: 177 IDERGEIKTEHYLPIHRDAPALVDLATGQEILATGIKVVDLLAPYQRGGKIGLFG 231 >At2g07698.1 68415.m00949 ATP synthase alpha chain, mitochondrial, putative very strong similarity to SP|P23413 ATP synthase alpha chain, mitochondrial (EC 3.6.3.14) {Brassica campestris}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 777 Score = 31.9 bits (69), Expect = 0.40 Identities = 15/55 (27%), Positives = 27/55 (49%) Frame = +3 Query: 510 IDERGPIPTDKTAAIHAEAPEFVDMSVQQEILVTGIRVVDLLAPYAKGGKIGLFG 674 ID +G + + + +AP ++ E + TG++ VD L P +G + L G Sbjct: 387 IDGKGALSDHEQRRVEVKAPGILERKSVHEPMQTGLKAVDSLVPIGRGQRELLIG 441 Score = 31.1 bits (67), Expect = 0.70 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +1 Query: 352 VAQHLGENTVRTIAMDGTEGLVRGQPVLDSGSPIRIPVGAETLGRIINVIG 504 +A +L V + G + G V +GS + +P G LGR+++ +G Sbjct: 334 MALNLENENVGIVVFGGDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDAMG 384 >At3g16860.1 68416.m02156 phytochelatin synthetase-related contains Pfam PF04833: Phytochelatin synthetase-like conserved region Length = 653 Score = 29.9 bits (64), Expect = 1.6 Identities = 23/85 (27%), Positives = 33/85 (38%), Gaps = 6/85 (7%) Frame = -2 Query: 467 PTGIRMGEPESSTGCPRTKPSVPSMAMVRTVFSP---KCCATSKXKRGDRFCTSRAFRIG 297 P + + ++G P K + S +V + P KCC + D + G Sbjct: 374 PLRVSSSQFPDTSGLPSNKSAFASWQVVCNITQPTPPKCCVSFSSYFNDSVIPCKTCACG 433 Query: 296 GKLSSN*T---STTAPIRQLPYLAL 231 G S STT+P LPY AL Sbjct: 434 GCSSDRVARTCSTTSPALPLPYQAL 458 >At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +3 Query: 504 RTIDERGPIPTDKTAAIHAEAPEFVDMSVQQEILVTGIRVVDLLAPYAKGGKIGLF 671 + ID PI + I + + + +E++ TGI +D++ A+G KI LF Sbjct: 110 KPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLF 165 >At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +3 Query: 504 RTIDERGPIPTDKTAAIHAEAPEFVDMSVQQEILVTGIRVVDLLAPYAKGGKIGLF 671 + ID PI + I + + + +E++ TGI +D++ A+G KI LF Sbjct: 110 KPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLF 165 >At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATPase B subunit / vacuolar proton pump B subunit / V-ATPase 57 kDa subunit identical to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana} Length = 486 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +3 Query: 504 RTIDERGPIPTDKTAAIHAEAPEFVDMSVQQEILVTGIRVVDLLAPYAKGGKIGLF 671 + ID PI + I + + + +E++ TGI +D++ A+G KI LF Sbjct: 109 KPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLF 164 >At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 485 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +3 Query: 504 RTIDERGPIPTDKTAAIHAEAPEFVDMSVQQEILVTGIRVVDLLAPYAKGGKIGLF 671 + ID PI + I + + + +E++ TGI +D++ A+G KI LF Sbjct: 109 KPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLF 164 >At1g20260.1 68414.m02529 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 330 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +3 Query: 504 RTIDERGPIPTDKTAAIHAEAPEFVDMSVQQEILVTGIRVVDLLAPYAKGGKIGLF 671 + ID PI + I + + + +E++ TGI +D++ A+G KI LF Sbjct: 109 KPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLF 164 >At3g42820.1 68416.m04484 hypothetical protein hypothetical proteins - Arabidopsis thaliana Length = 906 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = -2 Query: 551 SSSLVGWDGTALVNRSPITLMMRPRVSAPTGIRMGEPESSTGC 423 SS +V + + +++ P RP+ P G R P GC Sbjct: 311 SSGVVSMESISRISKDPANGTSRPKKDVPDGTRGVSPSKDMGC 353 >At1g50790.1 68414.m05712 hypothetical protein Length = 812 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +1 Query: 439 SGSPIRIPVGAETLGRIINV-IGERLTSAVPSQPTRLLLSMPKL 567 S SPI++ + +L +++NV I ER A+ S+P LL P+L Sbjct: 253 SESPIKVEIDLSSLCKLVNVWIWERF-RALQSKPNLLLKGEPRL 295 >At3g59010.1 68416.m06577 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 529 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = -1 Query: 393 GNGTYSVLSQVLRHLQXQAGRSILHL 316 G+GT+ +++ L L+ +GRS++HL Sbjct: 235 GSGTHMSVAEALASLEKGSGRSVIHL 260 >At3g11340.1 68416.m01379 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 447 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -2 Query: 326 FCTSRAFRIGGKLSSN*TSTTAPIRQLPYLALCRKPWLHS 207 F R G LS T +P+ +LPYL + PW + Sbjct: 140 FSKFHVLREKGYLSLQETKADSPVPELPYLRMKDLPWFQT 179 >At1g76550.1 68414.m08908 pyrophosphate--fructose-6-phosphate 1-phosphotransferase alpha subunit, putative / pyrophosphate-dependent 6-phosphofructose-1-kinase, putative strong similarity to SP|Q41140 Pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha subunit (EC 2.7.1.90) (PFP) (PPI-PFK) {Ricinus communis}; contains Pfam profile PF00365: Phosphofructokinase Length = 617 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +2 Query: 530 PNRQDCCYPCRSSRVCXHVCAAGDSRNWYKSRRSARSLCQRWK 658 P++ DC Y VC H+ AAG + + + +S +WK Sbjct: 437 PSKFDCDYAYVLGHVCYHILAAG-LNGYMATVTNLKSPVNKWK 478 >At1g28380.1 68414.m03487 expressed protein Length = 612 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = -3 Query: 610 VTRISCCTDMSTN---SGASAWIAAVLSVGMGPRSSIVR 503 VTR SC ++STN SG + I+ LS G+ P + + Sbjct: 498 VTRKSCWDNLSTNSRKSGVFSMISTRLSTGLSPNPATTK 536 >At1g04150.1 68414.m00405 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1012 Score = 27.5 bits (58), Expect = 8.7 Identities = 9/29 (31%), Positives = 13/29 (44%) Frame = +2 Query: 587 CAAGDSRNWYKSRRSARSLCQRWKDWVVW 673 C A W ++R SLC +W + W Sbjct: 632 CVAKYGPKWVRTRTVVDSLCPKWNEQYTW 660 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,461,594 Number of Sequences: 28952 Number of extensions: 324207 Number of successful extensions: 900 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 871 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 897 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -