BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30863 (723 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 25 0.82 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 25 0.82 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 22 4.4 AF265299-1|AAG17642.1| 63|Tribolium castaneum putative cytochr... 21 7.6 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 24.6 bits (51), Expect = 0.82 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +1 Query: 571 NTSY*NLVYFLPNALNSL*YRFLNDECIKLNNNFVQ 678 + SY NL F+P +N+L + FLND + + F Q Sbjct: 182 DVSY-NLFSFVPLVVNALDHLFLNDILSDICDKFEQ 216 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 24.6 bits (51), Expect = 0.82 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +1 Query: 571 NTSY*NLVYFLPNALNSL*YRFLNDECIKLNNNFVQ 678 + SY NL F+P +N+L + FLND + + F Q Sbjct: 138 DVSY-NLFSFVPLVVNALDHLFLNDILSDICDKFEQ 172 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = -2 Query: 671 KLLLSFIHSSFKNLYYKEFNAFGKK*TKF*YEVFNTHEKLQLI 543 K++ SF + ++ + FN KK + + +FN + L L+ Sbjct: 87 KVIKSFFNQGYELSKQEIFNCCSKKSFRMNFAIFNLYMVLLLL 129 >AF265299-1|AAG17642.1| 63|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 63 Score = 21.4 bits (43), Expect = 7.6 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -2 Query: 560 EKLQLI*KEKKPFVSKNIFQ--AYLSL 486 E++ L KEKKP VS + Q YL L Sbjct: 25 EQVALFGKEKKPIVSYSDLQEMKYLEL 51 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,467 Number of Sequences: 336 Number of extensions: 3391 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19259425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -