BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30863 (723 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces... 29 0.67 SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizo... 26 6.3 >SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1727 Score = 29.1 bits (62), Expect = 0.67 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 4/72 (5%) Frame = -2 Query: 563 HEKLQLI*KEKKPFVSKNIFQAYLS-LKKKLMLIFVINALLIIIE---EHSSHIGMLHFI 396 HE L + ++ KP VS N F ++S +K K+ I + L++ E EH ++ + I Sbjct: 14 HEFLDVSFEDIKPLVSVNGFAVFISAIKTKVKDINALKDQLVLQEVNHEHKENV-LTKKI 72 Query: 395 SVEHNQIKSQNN 360 + Q++S NN Sbjct: 73 NFLEQQLQSSNN 84 >SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1826 Score = 25.8 bits (54), Expect = 6.3 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -1 Query: 219 SVASSAYCGSTDGMAEQFFEMSFEITTTHWRANYSKFELNMFML 88 SV S Y GS+ + + M T T W +Y F + MF L Sbjct: 1409 SVLYSLYTGSSIYLGSRLIMMLLFGTMTVWTTHYVYFWVTMFAL 1452 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,790,836 Number of Sequences: 5004 Number of extensions: 54186 Number of successful extensions: 128 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 339215786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -