BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30863 (723 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53570| Best HMM Match : Y_phosphatase (HMM E-Value=0) 29 2.9 SB_13734| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_53570| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 2064 Score = 29.5 bits (63), Expect = 2.9 Identities = 19/67 (28%), Positives = 31/67 (46%) Frame = +1 Query: 10 RYARAARTLGHVTDPRPKRDCNL*RPQHKHV*FEL*VICSPMRCGNFKRHFEELFGHAVS 189 R+ GHVT R +R+ + + Q +++ F I + CGN + H L H Sbjct: 1717 RHEETVDIYGHVTVLRTQRNYMV-QTQEQYI-FSHDAILEAVSCGNTEVHARNLLHHIKK 1774 Query: 190 *TAIGRG 210 T +G+G Sbjct: 1775 LTELGKG 1781 >SB_13734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 278 Score = 27.9 bits (59), Expect = 8.8 Identities = 13/48 (27%), Positives = 31/48 (64%) Frame = +1 Query: 331 RFATLTLACQLF*DLIWLCSTEIKCNIPIWLECSSIMIRRALITKMSI 474 R+++++ A L D+I + S ++ IP++L+C++ +R + T+ S+ Sbjct: 40 RYSSVSRASSLDADIIGMSSKKMISRIPLFLKCATTGLRILVKTRGSL 87 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,291,830 Number of Sequences: 59808 Number of extensions: 383623 Number of successful extensions: 939 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 939 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -