BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30863 (723 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22925-1|CAA80505.1| 211|Anopheles gambiae ANG12 precursor prot... 25 3.1 AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 23 9.6 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 23 9.6 >Z22925-1|CAA80505.1| 211|Anopheles gambiae ANG12 precursor protein. Length = 211 Score = 24.6 bits (51), Expect = 3.1 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 38 DMLQILDQSGTATFEDLNI 94 D+LQ L+++G +E LN+ Sbjct: 83 DLLQYLEEAGVPAYESLNV 101 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.0 bits (47), Expect = 9.6 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = -2 Query: 476 LMLIFVINALLIIIEEHSSHIGMLHFISVEHNQIKSQNNWHARVS 342 +ML+ +I A + + GML+FI + ++I W+A V+ Sbjct: 286 VMLVLLIRACTL----EGAADGMLYFIKPQWDRILEAKVWYAAVT 326 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.0 bits (47), Expect = 9.6 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = -2 Query: 476 LMLIFVINALLIIIEEHSSHIGMLHFISVEHNQIKSQNNWHARVS 342 +ML+ +I A + + GML+FI + ++I W+A V+ Sbjct: 286 VMLVLLIRACTL----EGAADGMLYFIKPQWDRILEAKVWYAAVT 326 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 702,068 Number of Sequences: 2352 Number of extensions: 13837 Number of successful extensions: 20 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -