BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30863 (723 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016688-5|AAB66073.1| 666|Caenorhabditis elegans Hypothetical ... 29 4.4 AC024809-9|AAO12399.1| 700|Caenorhabditis elegans Hypothetical ... 28 7.8 AC024809-8|AAF59546.2| 741|Caenorhabditis elegans Hypothetical ... 28 7.8 >AF016688-5|AAB66073.1| 666|Caenorhabditis elegans Hypothetical protein F18A12.7 protein. Length = 666 Score = 28.7 bits (61), Expect = 4.4 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Frame = +1 Query: 319 HVPGRFAT--LTLACQLF*DLIWLCSTE-IKCNIPIWLECSSIMIRRALITKMSINFF 483 HVP + T L L Q + W + +K N + CSS+ I+ +LIT IN F Sbjct: 524 HVPSQKYTQKLLLEDQEHVEYRWTVKAQSLKLNDLLASNCSSLTIQNSLITSQDINLF 581 >AC024809-9|AAO12399.1| 700|Caenorhabditis elegans Hypothetical protein Y53G8AR.2b protein. Length = 700 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -1 Query: 108 ELNMFMLRSSKVAVPLWSRICNMSESSCGACV 13 EL M +VA WS++C++ ++ GACV Sbjct: 333 ELRAPMTSFERVAEERWSQMCSVCDTRQGACV 364 >AC024809-8|AAF59546.2| 741|Caenorhabditis elegans Hypothetical protein Y53G8AR.2a protein. Length = 741 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -1 Query: 108 ELNMFMLRSSKVAVPLWSRICNMSESSCGACV 13 EL M +VA WS++C++ ++ GACV Sbjct: 374 ELRAPMTSFERVAEERWSQMCSVCDTRQGACV 405 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,484,225 Number of Sequences: 27780 Number of extensions: 307291 Number of successful extensions: 605 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 605 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1697838058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -