BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30863 (723 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 2.2 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 3.9 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 6.7 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 8.9 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 23.4 bits (48), Expect = 2.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 497 MLGKYFC*RMAFFPSRLTATFH 562 M G+++C R + S +T+ FH Sbjct: 6 MAGQHYCLRWNNYQSNMTSVFH 27 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.6 bits (46), Expect = 3.9 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 507 FPSIFVIEKKINAHFRDQRPSY 442 +PS I++ +NA R Q P Y Sbjct: 590 WPSTSQIQRGVNAAIRSQEPFY 611 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -2 Query: 389 EHNQIKSQNNWHARVSVAK 333 +HN+ KS+NN H K Sbjct: 56 DHNKEKSKNNHHCNQDTEK 74 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 8.9 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 147 FQTTFRRIVRPCRQLNRNRPRKPPMGDLKDG 239 + F+ + R+ NR KP +GD+K G Sbjct: 363 YYNIFKALRNRARKARANR--KPNLGDIKPG 391 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,414 Number of Sequences: 438 Number of extensions: 3592 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -