BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30863 (723 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13330.1 68416.m01678 expressed protein 31 0.77 At5g22540.1 68418.m02630 expressed protein contains Pfam profile... 27 9.5 >At3g13330.1 68416.m01678 expressed protein Length = 1711 Score = 31.1 bits (67), Expect = 0.77 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -1 Query: 195 GSTDG-MAEQFFEMSFEITTTHWRANYSKFELNMFMLRSSKV 73 GST G + Q MSF+ ++ HWR N + + ++ SS++ Sbjct: 1008 GSTSGDLVSQIGSMSFDSSSLHWRYNLMANRVLLLLVMSSRI 1049 >At5g22540.1 68418.m02630 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 440 Score = 27.5 bits (58), Expect = 9.5 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = -1 Query: 198 CGSTDGMAEQFFEMSFEITTTHWRANYSKFELNMF-MLRSSKVAVPLWSRICNMSESS 28 C + +A +FF S + T W +Y ++ ++R + V VP RI + S S Sbjct: 188 CSGLNEIAFEFFNYSLQKPETFWEKHYGLEAKHLLDLIRKTFVPVPSQRRIKDHSSKS 245 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,169,165 Number of Sequences: 28952 Number of extensions: 270464 Number of successful extensions: 632 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 632 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1575119672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -