BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30861 (558 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02960.1 68418.m00239 40S ribosomal protein S23 (RPS23B) ribo... 118 3e-27 At3g09680.1 68416.m01147 40S ribosomal protein S23 (RPS23A) simi... 118 3e-27 At4g05280.1 68417.m00799 Ulp1 protease family protein contains P... 31 0.39 At2g14770.2 68415.m01669 Ulp1 protease family protein similar to... 31 0.69 At2g14770.1 68415.m01668 Ulp1 protease family protein similar to... 31 0.69 At1g34740.1 68414.m04319 Ulp1 protease family protein contains P... 31 0.69 At5g50790.1 68418.m06292 nodulin MtN3 family protein similar to ... 29 2.8 At3g42730.1 68416.m04462 Ulp1 protease family protein contains P... 28 4.9 At1g32960.1 68414.m04059 subtilase family protein contains simil... 28 4.9 At1g32940.1 68414.m04057 subtilase family protein contains simil... 28 4.9 >At5g02960.1 68418.m00239 40S ribosomal protein S23 (RPS23B) ribosomal protein S23, Fragaria x ananassa, PIR:S56673 Length = 142 Score = 118 bits (284), Expect = 3e-27 Identities = 54/65 (83%), Positives = 60/65 (92%) Frame = +2 Query: 242 KESDPFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKK 421 K+ FVP DGCLN+IEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKK Sbjct: 78 KKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKK 137 Query: 422 ERPRS 436 E+PRS Sbjct: 138 EKPRS 142 Score = 112 bits (269), Expect = 2e-25 Identities = 49/64 (76%), Positives = 57/64 (89%) Frame = +3 Query: 57 RREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIK 236 R QRWADK++KK+H+G +WK PF G+SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIK Sbjct: 17 RINQRWADKQYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIK 75 Query: 237 NGKK 248 NGKK Sbjct: 76 NGKK 79 >At3g09680.1 68416.m01147 40S ribosomal protein S23 (RPS23A) similar to 40S ribosomal protein S23 (S12) GB:P46297 from [Fragaria x ananassa] Length = 142 Score = 118 bits (284), Expect = 3e-27 Identities = 54/65 (83%), Positives = 60/65 (92%) Frame = +2 Query: 242 KESDPFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKK 421 K+ FVP DGCLN+IEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKK Sbjct: 78 KKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKK 137 Query: 422 ERPRS 436 E+PRS Sbjct: 138 EKPRS 142 Score = 103 bits (247), Expect = 8e-23 Identities = 47/64 (73%), Positives = 54/64 (84%) Frame = +3 Query: 57 RREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIK 236 R QRWADK +KK++ G +WK PF +SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIK Sbjct: 17 RITQRWADKHYKKSNRGNEWK-KPFACSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIK 75 Query: 237 NGKK 248 NGKK Sbjct: 76 NGKK 79 >At4g05280.1 68417.m00799 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At1g25886, At4g03300 Length = 1312 Score = 31.5 bits (68), Expect = 0.39 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 236 ERKESDPFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVV-KVANVS 394 E K+S P VP+ + E D+V GF K V D+P + +VV + NVS Sbjct: 820 EEKKSSPKVPKKVKNQLVYEQDDVHPHGFKAKTVLVPDVPNQQIEVVIRAENVS 873 >At2g14770.2 68415.m01669 Ulp1 protease family protein similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1158 Score = 30.7 bits (66), Expect = 0.69 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 236 ERKESDPFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVV-KVANVS 394 E K+S P VP+ + E D+ GF K V D+P + +VV + NVS Sbjct: 868 EEKKSSPKVPKKVKKQLVYEQDDAHPHGFKAKTVLVPDVPAQQIEVVIRAGNVS 921 >At2g14770.1 68415.m01668 Ulp1 protease family protein similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1139 Score = 30.7 bits (66), Expect = 0.69 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 236 ERKESDPFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVV-KVANVS 394 E K+S P VP+ + E D+ GF K V D+P + +VV + NVS Sbjct: 849 EEKKSSPKVPKKVKKQLVYEQDDAHPHGFKAKTVLVPDVPAQQIEVVIRAGNVS 902 >At1g34740.1 68414.m04319 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300 Length = 1383 Score = 30.7 bits (66), Expect = 0.69 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 236 ERKESDPFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVV-KVANVS 394 E K+S P VP+ + E D+ GF K V D+P + +VV + NVS Sbjct: 820 EEKKSSPKVPKKVKKQLVYEQDDAHPHGFKAKTVLVPDVPAQQIEVVIRAGNVS 873 >At5g50790.1 68418.m06292 nodulin MtN3 family protein similar to MtN3 GI:1619602 (root nodule development) from [Medicago truncatula] Length = 289 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +2 Query: 371 VVKVANVSLLALYKEKKERPRS*VYIVISDLLSGSALFI 487 VV++ +SL Y KKE+ + +++ D+L A+F+ Sbjct: 80 VVQIVYISLFFFYAPKKEKTLTVKFVLFVDVLGFGAIFV 118 >At3g42730.1 68416.m04462 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300 Length = 1314 Score = 27.9 bits (59), Expect = 4.9 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 236 ERKESDPFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVV-KVANVS 394 E K++ P VP+ + E D+ GF K V D+P + +VV + NVS Sbjct: 886 EEKKASPKVPKKVKKQLVYEQDDAHPDGFKAKTVLVPDVPTQQTEVVIRAGNVS 939 >At1g32960.1 68414.m04059 subtilase family protein contains similarity to subtilase; SP1 GI:9957714 [Oryza sativa] Length = 777 Score = 27.9 bits (59), Expect = 4.9 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 72 WADKEFKKAHMGTKWKANPFGGASHAKG 155 W+ F+ A + T W+ +PFG A+G Sbjct: 575 WSPAAFRSAIVTTAWRTDPFGEQIFAEG 602 >At1g32940.1 68414.m04057 subtilase family protein contains similarity to subtilase; SP1 GI:9957714 from [Oryza sativa] Length = 774 Score = 27.9 bits (59), Expect = 4.9 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 72 WADKEFKKAHMGTKWKANPFGGASHAKG 155 W+ F+ A + T W+ +PFG A+G Sbjct: 572 WSPAAFRSAIVTTAWRTDPFGEQIFAEG 599 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,492,039 Number of Sequences: 28952 Number of extensions: 269456 Number of successful extensions: 666 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 664 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1062855648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -