BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30859 (435 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35451| Best HMM Match : Ribosomal_L36e (HMM E-Value=0) 61 3e-10 SB_22067| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_45611| Best HMM Match : p450 (HMM E-Value=0) 28 3.8 >SB_35451| Best HMM Match : Ribosomal_L36e (HMM E-Value=0) Length = 100 Score = 61.3 bits (142), Expect = 3e-10 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 255 KDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRK 359 KDKRALKF K+RLGTH+R KRKREE+++VLA MRK Sbjct: 59 KDKRALKFCKKRLGTHVRGKRKREEITSVLAAMRK 93 Score = 59.7 bits (138), Expect = 1e-09 Identities = 33/63 (52%), Positives = 39/63 (61%) Frame = +1 Query: 52 IAVGLRKGHKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKR 231 +AVGL+KGHK TK + +P+R KG K KFVRD+VREVVG A YEKR Sbjct: 1 MAVGLQKGHKVTK----------NVTKPKPSRRKGASNKRVKFVRDVVREVVGFAPYEKR 50 Query: 232 AME 240 ME Sbjct: 51 VME 53 >SB_22067| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 705 Score = 29.5 bits (63), Expect = 1.3 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = -1 Query: 165 RLKTL*SSWPNS----DGFVCDTLAASGYFSCFVAFSQAYCDFKTRSHDFGLTDPK 10 RLK++ SW N+ G CD A+G F V FS + K R H D K Sbjct: 440 RLKSMRWSWENARTSKGGQSCDDPDATGDFEDEVTFSDPHLQKKFRRHSLKTLDTK 495 >SB_45611| Best HMM Match : p450 (HMM E-Value=0) Length = 847 Score = 27.9 bits (59), Expect = 3.8 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = +3 Query: 255 KDKRALKFLKRRLGTHIRAKRKREELSN 338 K RALKFLK RL +R KR E L N Sbjct: 60 KSPRALKFLKTRL-QDLRKKRDSETLRN 86 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,521,985 Number of Sequences: 59808 Number of extensions: 204010 Number of successful extensions: 551 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 834771332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -