BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30854 (765 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56628| Best HMM Match : Actin (HMM E-Value=0) 173 2e-43 SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 172 2e-43 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 172 2e-43 SB_56| Best HMM Match : Actin (HMM E-Value=0) 172 2e-43 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 169 2e-42 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 169 2e-42 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 143 2e-34 SB_54| Best HMM Match : Actin (HMM E-Value=0) 102 3e-22 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 8e-18 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 55 7e-08 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 55 7e-08 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 53 3e-07 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_30755| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) 33 0.25 SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.58 SB_48528| Best HMM Match : Extensin_2 (HMM E-Value=1) 29 4.1 SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) 29 5.4 SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) 29 5.4 SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) 29 5.4 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 29 5.4 SB_8145| Best HMM Match : RNA_pol_Rpb2_6 (HMM E-Value=0) 28 7.2 SB_53874| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_12796| Best HMM Match : Radical_SAM (HMM E-Value=8.9e-24) 28 9.5 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 173 bits (420), Expect = 2e-43 Identities = 80/84 (95%), Positives = 82/84 (97%) Frame = +1 Query: 1 IKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEA 180 IKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ Sbjct: 213 IKEKLCYVALDFEQEMTTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMES 272 Query: 181 CGIHETTYNSIMKCDVDIRKDLYA 252 GIHETTYNSIMKCDVDIRKDLYA Sbjct: 273 AGIHETTYNSIMKCDVDIRKDLYA 296 Score = 164 bits (399), Expect = 6e-41 Identities = 77/83 (92%), Positives = 79/83 (95%) Frame = +3 Query: 243 LVRQTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 422 L TVLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 294 LYANTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTF 353 Query: 423 QQMWISKQEYDESGPSIVHRKCF 491 QQMWISKQEYDESGPSIVHRKCF Sbjct: 354 QQMWISKQEYDESGPSIVHRKCF 376 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 172 bits (419), Expect = 2e-43 Identities = 80/84 (95%), Positives = 82/84 (97%) Frame = +1 Query: 1 IKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEA 180 IKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ Sbjct: 175 IKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMES 234 Query: 181 CGIHETTYNSIMKCDVDIRKDLYA 252 GIHETTYNSIMKCDVDIRKDLYA Sbjct: 235 AGIHETTYNSIMKCDVDIRKDLYA 258 Score = 165 bits (400), Expect = 5e-41 Identities = 77/83 (92%), Positives = 79/83 (95%) Frame = +3 Query: 243 LVRQTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 422 L TVLSGGTTMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 256 LYANTVLSGGTTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTF 315 Query: 423 QQMWISKQEYDESGPSIVHRKCF 491 QQMWISKQEYDESGP+IVHRKCF Sbjct: 316 QQMWISKQEYDESGPAIVHRKCF 338 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 172 bits (419), Expect = 2e-43 Identities = 80/84 (95%), Positives = 82/84 (97%) Frame = +1 Query: 1 IKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEA 180 IKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ Sbjct: 213 IKEKLCYVALDFEQEMETAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMES 272 Query: 181 CGIHETTYNSIMKCDVDIRKDLYA 252 GIHETTYNSIMKCDVDIRKDLYA Sbjct: 273 AGIHETTYNSIMKCDVDIRKDLYA 296 Score = 165 bits (400), Expect = 5e-41 Identities = 77/83 (92%), Positives = 79/83 (95%) Frame = +3 Query: 243 LVRQTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 422 L TVLSGG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 294 LYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTF 353 Query: 423 QQMWISKQEYDESGPSIVHRKCF 491 QQMWISKQEYDESGPSIVHRKCF Sbjct: 354 QQMWISKQEYDESGPSIVHRKCF 376 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 172 bits (419), Expect = 2e-43 Identities = 80/84 (95%), Positives = 82/84 (97%) Frame = +1 Query: 1 IKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEA 180 IKEKLCYVALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ Sbjct: 212 IKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMES 271 Query: 181 CGIHETTYNSIMKCDVDIRKDLYA 252 GIHETTYNSIMKCDVDIRKDLYA Sbjct: 272 AGIHETTYNSIMKCDVDIRKDLYA 295 Score = 165 bits (400), Expect = 5e-41 Identities = 77/83 (92%), Positives = 79/83 (95%) Frame = +3 Query: 243 LVRQTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 422 L TVLSGG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 293 LYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTF 352 Query: 423 QQMWISKQEYDESGPSIVHRKCF 491 QQMWISKQEYDESGPSIVHRKCF Sbjct: 353 QQMWISKQEYDESGPSIVHRKCF 375 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 169 bits (412), Expect = 2e-42 Identities = 79/84 (94%), Positives = 82/84 (97%) Frame = +1 Query: 1 IKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEA 180 IKEKL YVALDFEQEMATAA+SSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ Sbjct: 212 IKEKLAYVALDFEQEMATAAASSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMES 271 Query: 181 CGIHETTYNSIMKCDVDIRKDLYA 252 GIHETTYNSIMKCDVDIRKDLYA Sbjct: 272 AGIHETTYNSIMKCDVDIRKDLYA 295 Score = 163 bits (395), Expect = 2e-40 Identities = 76/83 (91%), Positives = 79/83 (95%) Frame = +3 Query: 243 LVRQTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 422 L TVLSGG+TM+PGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 293 LYANTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTF 352 Query: 423 QQMWISKQEYDESGPSIVHRKCF 491 QQMWISKQEYDESGPSIVHRKCF Sbjct: 353 QQMWISKQEYDESGPSIVHRKCF 375 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 169 bits (412), Expect = 2e-42 Identities = 79/84 (94%), Positives = 81/84 (96%) Frame = +1 Query: 1 IKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEA 180 IKEKLCYVALDFEQEM TAASSSS+EKSYELPDGQVITIGNERFRCPEAL QPSFLGME+ Sbjct: 186 IKEKLCYVALDFEQEMQTAASSSSIEKSYELPDGQVITIGNERFRCPEALLQPSFLGMES 245 Query: 181 CGIHETTYNSIMKCDVDIRKDLYA 252 GIHETTYNSIMKCDVDIRKDLYA Sbjct: 246 SGIHETTYNSIMKCDVDIRKDLYA 269 Score = 165 bits (401), Expect = 3e-41 Identities = 76/83 (91%), Positives = 80/83 (96%) Frame = +3 Query: 243 LVRQTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 422 L TV+SGGTTMYPG+ADRMQKEI+ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 267 LYANTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 326 Query: 423 QQMWISKQEYDESGPSIVHRKCF 491 QQMWISKQEYDESGP+IVHRKCF Sbjct: 327 QQMWISKQEYDESGPAIVHRKCF 349 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 143 bits (346), Expect = 2e-34 Identities = 65/83 (78%), Positives = 73/83 (87%) Frame = +3 Query: 243 LVRQTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 422 L VLSGG+TM+PGIADRMQKEI LA ++MK+K+IAPPERKYSVWIGGSILASLSTF Sbjct: 67 LYSNCVLSGGSTMFPGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGSILASLSTF 126 Query: 423 QQMWISKQEYDESGPSIVHRKCF 491 QQMWI+K+EY E GP IVHRKCF Sbjct: 127 QQMWIAKEEYHEYGPPIVHRKCF 149 Score = 118 bits (285), Expect = 4e-27 Identities = 53/65 (81%), Positives = 59/65 (90%) Frame = +1 Query: 58 ASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIR 237 A+S LEK+YELPDGQVI+IGNERFRCPEA+FQP+FLGMEA GIHE YN IMKCDVDIR Sbjct: 5 ANSPILEKTYELPDGQVISIGNERFRCPEAMFQPAFLGMEAPGIHEAIYNCIMKCDVDIR 64 Query: 238 KDLYA 252 KDLY+ Sbjct: 65 KDLYS 69 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 102 bits (245), Expect = 3e-22 Identities = 45/83 (54%), Positives = 59/83 (71%) Frame = +1 Query: 1 IKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEA 180 +KE LCY A+D+E+E+ A +S E Y LPDGQ I IG+ERFR E LFQPS LG + Sbjct: 2257 LKETLCYCAMDYERELKEAETSDDCEAPYMLPDGQSIRIGSERFRAAEPLFQPSLLGRDI 2316 Query: 181 CGIHETTYNSIMKCDVDIRKDLY 249 GIHE+ + SI KCD+D+R +L+ Sbjct: 2317 DGIHESIFKSIKKCDIDLRAELF 2339 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 87.8 bits (208), Expect = 8e-18 Identities = 37/83 (44%), Positives = 52/83 (62%) Frame = +1 Query: 1 IKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEA 180 +KEKLCYV + EQE A ++ L + Y LPDG+V+ + ERF PEALFQP + +E Sbjct: 216 MKEKLCYVGYNIEQEQKLALETTVLVEQYTLPDGRVVKLSGERFEAPEALFQPHLINVEG 275 Query: 181 CGIHETTYNSIMKCDVDIRKDLY 249 G+ E +N+I D+D R + Y Sbjct: 276 VGVAELLFNTIQAADIDTRSEFY 298 Score = 45.6 bits (103), Expect = 4e-05 Identities = 32/104 (30%), Positives = 52/104 (50%), Gaps = 2/104 (1%) Frame = +3 Query: 159 LVLGYGSLRHPRDHI*LHHEVRRGHP*GLVRQTVLSGGTTMYPGIADRMQKEITA-LAPS 335 +VL GS +P L E+++ L + VL G T+ Q +TA Sbjct: 301 IVLSGGSTMYPGLPSRLEREIKQ-----LYLERVLKGDTSKLSSGMGMEQIPLTADYLLQ 355 Query: 336 TMKIKIIAPPERKYSVWIGGSILAS-LSTFQQMWISKQEYDESG 464 KI+I PP RK+ V++GG++LA + W++++EY+E G Sbjct: 356 KFKIRIEDPPRRKHMVFMGGAVLADIMKDKDSFWMTRKEYEEKG 399 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 54.8 bits (126), Expect = 7e-08 Identities = 34/103 (33%), Positives = 53/103 (51%), Gaps = 16/103 (15%) Frame = +3 Query: 243 LVRQTVLSGGTTMYPGIADRMQKEITA----------------LAPSTMKIKIIAPPERK 374 L + VLSGG+TM+ R+Q++I + P ++ ++I+ ++ Sbjct: 242 LYKNIVLSGGSTMFRDFGRRLQRDIKRTVDARLKMSETLSGGRIKPKPIETQVISHHMQR 301 Query: 375 YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF*THR 503 Y+VW GGS+LAS F + +K +YDE GPSI F HR Sbjct: 302 YAVWFGGSMLASTPEFYSVCHTKADYDEHGPSICRHNPF-LHR 343 Score = 34.7 bits (76), Expect = 0.083 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +1 Query: 109 ITIGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLY 249 + + ERF PE F P F + + E N I C +D+R+ LY Sbjct: 196 VDVAYERFLGPEIFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLY 243 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 54.8 bits (126), Expect = 7e-08 Identities = 23/61 (37%), Positives = 41/61 (67%), Gaps = 3/61 (4%) Frame = +3 Query: 240 GLVRQTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSILAS 410 GL +++GG T+ G +R+ +E+ + P +M++K+I+ E++++ WIGGSILAS Sbjct: 170 GLFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRLKLISNNSSVEKRFNPWIGGSILAS 229 Query: 411 L 413 L Sbjct: 230 L 230 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 52.8 bits (121), Expect = 3e-07 Identities = 25/56 (44%), Positives = 35/56 (62%) Frame = +1 Query: 1 IKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFL 168 IKEK+CY++ D +E+ ++ L K Y LPDGQ+I+IG E E LF+P L Sbjct: 843 IKEKICYLSKDHLKEVHNYKTNEGLTKFYTLPDGQMISIGYECISSMEPLFRPDLL 898 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 38.3 bits (85), Expect = 0.007 Identities = 24/81 (29%), Positives = 35/81 (43%), Gaps = 9/81 (11%) Frame = +3 Query: 243 LVRQTVLSGGTTMYPGIADRMQKEITALAPS--------TMKIKIIAPP-ERKYSVWIGG 395 L VL GGT M PG R+ +EI L S +K+ PP + W+GG Sbjct: 77 LAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDKLFIKTVKMHQPPVNANITAWLGG 136 Query: 396 SILASLSTFQQMWISKQEYDE 458 +I SL +++ Y + Sbjct: 137 AIFGSLEVLADRSTTRERYQQ 157 >SB_30755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 906 Score = 36.3 bits (80), Expect = 0.027 Identities = 26/68 (38%), Positives = 36/68 (52%), Gaps = 5/68 (7%) Frame = +2 Query: 17 ATSLLTSSRKWPPL--HPAAPSRSLTNFP---TVRSSLSETKDSVAQRLSSNPRSWVWKL 181 +TS +T S K+PP+ +PA PS L P TV SLS T S+P S V L Sbjct: 452 STSSITGSSKYPPVSPNPAKPSNILFEGPSSSTVFKSLSPTDQMSNSPSQSSPGSSVSDL 511 Query: 182 AASTRPHI 205 + S+ P++ Sbjct: 512 SCSSDPNV 519 Score = 27.9 bits (59), Expect = 9.5 Identities = 27/105 (25%), Positives = 47/105 (44%) Frame = +2 Query: 14 CATSLLTSSRKWPPLHPAAPSRSLTNFPTVRSSLSETKDSVAQRLSSNPRSWVWKLAAST 193 CA ++ + ++ LH S S ++ PT+ + S T+DSV +S+ + V K+ T Sbjct: 779 CAENISSDQQESMALHTKPKSLSSSDLPTMVVTHSATRDSVT--VSTPILANVSKVGTGT 836 Query: 194 RPHITPS*SATWTSVRTCTPNRIVRWYHHVPWNRRPYAKGNHSSR 328 H P T S+ +P H+P + R +H S+ Sbjct: 837 --HNKPKSCETGESMTAMSPG------IHMPMDTRRVNSSSHGSQ 873 >SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) Length = 152 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +1 Query: 1 IKEKLCYVALDFEQEM 48 IKEKLCYVALDF QE+ Sbjct: 91 IKEKLCYVALDFYQEI 106 >SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 31.9 bits (69), Expect = 0.58 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +1 Query: 139 PEALFQPSFLGMEACGIHET 198 PE +FQPS LG+E GI ET Sbjct: 3 PEIIFQPSMLGLEQAGITET 22 >SB_48528| Best HMM Match : Extensin_2 (HMM E-Value=1) Length = 329 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 69 LPREVLRTSRRSGHHYRKRKIPLPRGSLP 155 LPR ++R HY++ +PLPRG P Sbjct: 132 LPRGGSPLTKRRESHYQEEGVPLPRGGSP 160 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 69 LPREVLRTSRRSGHHYRKRKIPLPRGSLP 155 LPR ++R HY++ +PLPRG P Sbjct: 154 LPRGGSPLTKRRESHYQEEGVPLPRGGGP 182 >SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) Length = 1382 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +2 Query: 11 SCATSLLTSSRKWPPLHPAAPSRSLTNFPTVRSSLSETKDSV 136 SCA S+ + L PA+P+ S++ F T++ T+ S+ Sbjct: 970 SCAEPRSIDSKHYTALSPASPASSISCFSTLQLKQMPTRSSI 1011 >SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) Length = 603 Score = 28.7 bits (61), Expect = 5.4 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +3 Query: 75 REVLRTSRRSGHHYRKRKIPLPR--GSLPTLVLGYGSLRHPR 194 R++LR R HHYR+ + R G++P + Y + R PR Sbjct: 521 RDLLRALRNKKHHYRELPDEVKRSLGTIPDEYVRYFTSRFPR 562 >SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) Length = 158 Score = 28.7 bits (61), Expect = 5.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 107 SSLSETKDSVAQRLSSNPRSWVWK 178 S+ SETK SV +R + + W+W+ Sbjct: 96 STKSETKASVVERFNRTSKEWMWR 119 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 28.7 bits (61), Expect = 5.4 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 4 KEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPE 144 +EK+ L+ E E A ++ LEK +L + +G+ER RC + Sbjct: 2983 REKIVTSDLESELETERALQANELEKQNKLLEKLSADLGHERSRCED 3029 >SB_8145| Best HMM Match : RNA_pol_Rpb2_6 (HMM E-Value=0) Length = 893 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 105 LTVGKFVRLLEGAAGCSGGHF 43 +TVGK + L+ G AG GHF Sbjct: 366 MTVGKLIELIAGKAGVLEGHF 386 >SB_53874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 27.9 bits (59), Expect = 9.5 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = +2 Query: 59 HPAAPSRSLTNFPTVRSSLSETKDSVAQRLSSNPRSWVWKLAASTRPHI 205 HP SR +N P V S + V R+ SN V+ S +PH+ Sbjct: 113 HPHVYSRVKSNHPHVYSRVKSNHPHVYSRVKSN-HPHVYSRVKSNQPHV 160 >SB_12796| Best HMM Match : Radical_SAM (HMM E-Value=8.9e-24) Length = 676 Score = 27.9 bits (59), Expect = 9.5 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = +2 Query: 59 HPAAPSRSLTNFPTVRSSLSETKDSVAQRLSSNPRSWVWKLAASTRPHI 205 HP SR +N P V S + V R+ SN V+ S +PH+ Sbjct: 615 HPHVYSRVKSNHPHVYSRVKSNHPHVYSRVKSN-HPHVYSRVKSNQPHV 662 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,707,771 Number of Sequences: 59808 Number of extensions: 568924 Number of successful extensions: 1820 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 1607 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1799 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -