BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30854 (765 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 151 9e-39 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.4 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 7.2 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 7.2 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 151 bits (365), Expect = 9e-39 Identities = 70/70 (100%), Positives = 70/70 (100%) Frame = +1 Query: 43 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 222 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC Sbjct: 1 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 60 Query: 223 DVDIRKDLYA 252 DVDIRKDLYA Sbjct: 61 DVDIRKDLYA 70 Score = 130 bits (314), Expect = 1e-32 Identities = 62/66 (93%), Positives = 63/66 (95%) Frame = +3 Query: 243 LVRQTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 422 L TVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPE+KYSVWIGGSILASLSTF Sbjct: 68 LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVWIGGSILASLSTF 127 Query: 423 QQMWIS 440 QQMWIS Sbjct: 128 QQMWIS 133 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +2 Query: 50 PPLHPAAPSRSLTNFPTVRSSLSETKDSVAQRLSSNPR 163 PP + + P S LS T ++A+ L PR Sbjct: 678 PPARSPSSQAQASQCPQTASLLSSTHSTLARSLMEGPR 715 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 7.2 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 Query: 257 RIVRWYHHVPWNRRPYAK 310 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 7.2 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 Query: 257 RIVRWYHHVPWNRRPYAK 310 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,590 Number of Sequences: 438 Number of extensions: 5143 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -