BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30851 (777 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 25 2.0 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 24 6.0 AY118017-1|AAM66816.1| 120|Anopheles gambiae glucose-6-phosphat... 23 8.0 AY118012-1|AAM66811.1| 120|Anopheles gambiae glucose-6-phosphat... 23 8.0 AY118011-1|AAM66810.1| 120|Anopheles gambiae glucose-6-phosphat... 23 8.0 AY118010-1|AAM66809.1| 120|Anopheles gambiae glucose-6-phosphat... 23 8.0 AY118002-1|AAM66801.1| 120|Anopheles gambiae glucose-6-phosphat... 23 8.0 AY118001-1|AAM66800.1| 120|Anopheles gambiae glucose-6-phosphat... 23 8.0 AY118000-1|AAM66799.1| 120|Anopheles gambiae glucose-6-phosphat... 23 8.0 AY117999-1|AAM66798.1| 120|Anopheles gambiae glucose-6-phosphat... 23 8.0 AY117998-1|AAM66797.1| 120|Anopheles gambiae glucose-6-phosphat... 23 8.0 AY117997-1|AAM66796.1| 120|Anopheles gambiae glucose-6-phosphat... 23 8.0 AY117996-1|AAM66795.1| 120|Anopheles gambiae glucose-6-phosphat... 23 8.0 AY117995-1|AAM66794.1| 120|Anopheles gambiae glucose-6-phosphat... 23 8.0 AY117994-1|AAM66793.1| 120|Anopheles gambiae glucose-6-phosphat... 23 8.0 AF317817-1|AAL18436.1| 137|Anopheles gambiae glucose-6-phosphat... 23 8.0 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 25.4 bits (53), Expect = 2.0 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +3 Query: 600 NVQSNAKRVMTSLPQKKRNTFHLSSAKPIRRQSTRL*SKPSEPDPTR-RCSADTSSGL 770 + +N KR+ +P K R T + +P+ + D R R ADT +GL Sbjct: 533 DANTNGKRLQQMMPSKHRTTAEGYTQRPVNYAVETIEHNAQVSDHYRHRAYADTVTGL 590 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 23.8 bits (49), Expect = 6.0 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +3 Query: 330 KHVR--RIRPNLKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 461 KHV+ + +LK +VC+ + +RVV GI SGL L +GP Sbjct: 109 KHVKFCQFAFDLKCDSVCV---NPYHYERVVSPGIDLSGLTLQSGP 151 >AY118017-1|AAM66816.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 504 YVSAPPPEFHSATSNCQNTSM 566 Y++ PP F S T + +NT M Sbjct: 74 YLALPPSVFESVTVHIRNTCM 94 >AY118012-1|AAM66811.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 504 YVSAPPPEFHSATSNCQNTSM 566 Y++ PP F S T + +NT M Sbjct: 74 YLALPPSVFESVTVHIRNTCM 94 >AY118011-1|AAM66810.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 504 YVSAPPPEFHSATSNCQNTSM 566 Y++ PP F S T + +NT M Sbjct: 74 YLALPPSVFESVTVHIRNTCM 94 >AY118010-1|AAM66809.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 504 YVSAPPPEFHSATSNCQNTSM 566 Y++ PP F S T + +NT M Sbjct: 74 YLALPPSVFESVTVHIRNTCM 94 >AY118002-1|AAM66801.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 504 YVSAPPPEFHSATSNCQNTSM 566 Y++ PP F S T + +NT M Sbjct: 74 YLALPPSVFESVTVHIRNTCM 94 >AY118001-1|AAM66800.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 504 YVSAPPPEFHSATSNCQNTSM 566 Y++ PP F S T + +NT M Sbjct: 74 YLALPPSVFESVTVHIRNTCM 94 >AY118000-1|AAM66799.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 504 YVSAPPPEFHSATSNCQNTSM 566 Y++ PP F S T + +NT M Sbjct: 74 YLALPPSVFESVTVHIRNTCM 94 >AY117999-1|AAM66798.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 504 YVSAPPPEFHSATSNCQNTSM 566 Y++ PP F S T + +NT M Sbjct: 74 YLALPPSVFESVTVHIRNTCM 94 >AY117998-1|AAM66797.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 504 YVSAPPPEFHSATSNCQNTSM 566 Y++ PP F S T + +NT M Sbjct: 74 YLALPPSVFESVTVHIRNTCM 94 >AY117997-1|AAM66796.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 504 YVSAPPPEFHSATSNCQNTSM 566 Y++ PP F S T + +NT M Sbjct: 74 YLALPPSVFESVTVHIRNTCM 94 >AY117996-1|AAM66795.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 504 YVSAPPPEFHSATSNCQNTSM 566 Y++ PP F S T + +NT M Sbjct: 74 YLALPPSVFESVTVHIRNTCM 94 >AY117995-1|AAM66794.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 504 YVSAPPPEFHSATSNCQNTSM 566 Y++ PP F S T + +NT M Sbjct: 74 YLALPPSVFESVTVHIRNTCM 94 >AY117994-1|AAM66793.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 504 YVSAPPPEFHSATSNCQNTSM 566 Y++ PP F S T + +NT M Sbjct: 74 YLALPPSVFESVTVHIRNTCM 94 >AF317817-1|AAL18436.1| 137|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 137 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 504 YVSAPPPEFHSATSNCQNTSM 566 Y++ PP F S T + +NT M Sbjct: 82 YLALPPSVFESVTVHIRNTCM 102 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 817,944 Number of Sequences: 2352 Number of extensions: 17405 Number of successful extensions: 44 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -