BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30837 (745 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 101 5e-24 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 101 5e-24 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 92 4e-21 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 27 0.16 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 3.4 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 3.4 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 22 4.5 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 22 6.0 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 101 bits (243), Expect = 5e-24 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +2 Query: 584 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDT 745 INEPTAAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDT Sbjct: 1 INEPTAAAIAYGLDKKAEKERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDT 54 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 101 bits (243), Expect = 5e-24 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +2 Query: 584 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDT 745 INEPTAAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDT Sbjct: 1 INEPTAAAIAYGLDKKAERERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDT 54 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 92.3 bits (219), Expect = 4e-21 Identities = 42/54 (77%), Positives = 51/54 (94%) Frame = +2 Query: 584 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDT 745 INEPTAAAIAYGLDKKG E+N+L++DLGGGTFDVSILTI++G+FEV +T+GDT Sbjct: 1 INEPTAAAIAYGLDKKGA-EQNILVYDLGGGTFDVSILTIDNGVFEVVATSGDT 53 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 27.1 bits (57), Expect = 0.16 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = +3 Query: 177 DHSVLCCVHRHRASHRRCRQEPGGDEPNNTIFDAKRLI--GRKFEDATVQADMKHWPFEV 350 DH + +H + SH +QEP G +N F RL+ D + ADM + + Sbjct: 342 DHQAM--LHHNPMSHH-LKQEPSGFTSSNHPFSINRLLPTAESKADIKMYADMHQYGYNT 398 Query: 351 VS 356 +S Sbjct: 399 LS 400 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 129 LPAREGGDHRQRPGQQDH 182 +P R+ DHR RP + H Sbjct: 246 IPIRQCDDHRDRPPRHFH 263 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 539 TKDAGTISGLNVLRIINEPTAA 604 TKDAG +S + ++N+P A Sbjct: 330 TKDAGLLSYPEICTLLNDPQNA 351 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 22.2 bits (45), Expect = 4.5 Identities = 18/77 (23%), Positives = 36/77 (46%), Gaps = 1/77 (1%) Frame = -1 Query: 502 VITAFCTVLPR*ASAVSFIFVSTMELTSSGKKVLSSPLYATLILCLPPSLTTSKGQCF-M 326 +ITAF +VLP+ A +++ F L K + Y + + + ++ + C+ + Sbjct: 87 LITAFLSVLPQLAWDITYRFYGGFLLCKVVKYGQTLGPYLSSYVLMATAIDRHQAICYPL 146 Query: 325 SACTVASSNLRPMRRLA 275 + C+ S + M LA Sbjct: 147 TYCSWTSRRSKVMVYLA 163 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +2 Query: 479 NCAECSYHGSAYFNDSQ 529 N C Y+ AYF D Q Sbjct: 19 NKVVCYYNSKAYFRDGQ 35 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,688 Number of Sequences: 336 Number of extensions: 4300 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -