BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30834 (453 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M27364-1|AAA52344.1| 227|Homo sapiens EEF1A protein. 81 2e-15 X16869-1|CAA34756.1| 462|Homo sapiens protein ( Human mRNA for ... 79 5e-15 X03558-1|CAA27245.1| 462|Homo sapiens protein ( Human mRNA for ... 79 5e-15 M29548-1|AAA52367.1| 327|Homo sapiens EEF1A protein. 79 5e-15 J04617-1|AAA52343.1| 462|Homo sapiens EEF1A protein. 79 5e-15 EF362804-1|ABO30531.1| 462|Homo sapiens EF1a protein. 79 5e-15 DQ185041-1|ABD14421.1| 93|Homo sapiens eukaryotic translation ... 79 5e-15 BC111051-1|AAI11052.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC094687-1|AAH94687.1| 308|Homo sapiens EEF1A1 protein protein. 79 5e-15 BC082268-1|AAH82268.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC072385-1|AAH72385.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC071841-1|AAH71841.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC071741-1|AAH71741.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC071727-1|AAH71727.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC071619-1|AAH71619.1| 441|Homo sapiens EEF1A1 protein protein. 79 5e-15 BC066893-1|AAH66893.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC065761-1|AAH65761.1| 251|Homo sapiens EEF1A1 protein protein. 79 5e-15 BC063511-1|AAH63511.1| 290|Homo sapiens EEF1A1 protein protein. 79 5e-15 BC057391-1|AAH57391.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC038339-1|AAH38339.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC028674-1|AAH28674.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC022412-1|AAH22412.1| 250|Homo sapiens Unknown (protein for IM... 79 5e-15 BC021686-1|AAH21686.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC019669-1|AAH19669.1| 462|Homo sapiens EEF1A1 protein protein. 79 5e-15 BC018641-1|AAH18641.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC018150-1|AAH18150.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC014892-1|AAH14892.1| 248|Homo sapiens Unknown (protein for IM... 79 5e-15 BC014377-1|AAH14377.1| 287|Homo sapiens Unknown (protein for IM... 79 5e-15 BC014224-1|AAH14224.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC012891-1|AAH12891.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC012509-1|AAH12509.1| 161|Homo sapiens EEF1A1 protein protein. 79 5e-15 BC010735-1|AAH10735.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC009875-1|AAH09875.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC009733-1|AAH09733.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 BC008587-1|AAH08587.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 AY043301-1|AAK95378.1| 462|Homo sapiens elongation factor 1-alp... 79 5e-15 AL603910-8|CAI14883.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 AL593851-4|CAH73620.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 AK223046-1|BAD96766.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 AK223042-1|BAD96762.1| 433|Homo sapiens eukaryotic translation ... 79 5e-15 AK223030-1|BAD96750.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 AK222982-1|BAD96702.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 AK222551-1|BAD96271.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 AK222523-1|BAD96243.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 AK222519-1|BAD96239.1| 366|Homo sapiens eukaryotic translation ... 79 5e-15 AK222515-1|BAD96235.1| 462|Homo sapiens eukaryotic translation ... 79 5e-15 AF397403-1|AAK93966.1| 398|Homo sapiens translation elongation ... 79 5e-15 AF328730-1|AAN09722.1| 361|Homo sapiens CTCL tumor antigen HD-C... 79 5e-15 AF322220-1|AAN51932.1| 361|Homo sapiens cervical cancer suppres... 79 5e-15 AF174496-1|AAF36537.1| 426|Homo sapiens glucocorticoid receptor... 79 5e-15 X70940-1|CAA50280.1| 463|Homo sapiens elongation factor 1 alpha... 76 5e-14 L41498-1|AAC09386.1| 398|Homo sapiens longation factor 1-alpha ... 76 5e-14 L41490-1|AAC09385.1| 398|Homo sapiens eukaryotic translation el... 76 5e-14 BC110409-1|AAI10410.1| 463|Homo sapiens eukaryotic translation ... 76 5e-14 BC000432-1|AAH00432.1| 463|Homo sapiens eukaryotic translation ... 76 5e-14 AY062434-1|AAL38981.1| 398|Homo sapiens elongation factor 1-alp... 76 5e-14 AL121829-9|CAC15522.1| 463|Homo sapiens EEF1A2 protein. 76 5e-14 AF163763-1|AAF80488.1| 463|Homo sapiens elongation factor 1 A-2... 76 5e-14 L10340-1|AAA91835.1| 435|Homo sapiens elongation factor-1 alpha... 73 3e-13 AF267861-1|AAG44730.1| 427|Homo sapiens EF1a-like protein protein. 43 4e-04 X17644-1|CAA35635.1| 499|Homo sapiens protein ( Human GST1-Hs m... 42 0.001 U95742-2|AAB67250.1| 499|Homo sapiens G1 to S phase transition ... 42 0.001 BT006722-1|AAP35368.1| 498|Homo sapiens G1 to S phase transitio... 42 0.001 BC036077-1|AAH36077.1| 628|Homo sapiens G1 to S phase transitio... 42 0.001 BC009503-1|AAH09503.2| 633|Homo sapiens GSPT1 protein protein. 42 0.001 AL929101-2|CAH71524.1| 628|Homo sapiens G1 to S phase transitio... 42 0.001 AK001303-1|BAA91612.1| 628|Homo sapiens protein ( Homo sapiens ... 42 0.001 AJ251548-1|CAB91089.1| 628|Homo sapiens polypeptide chain relea... 42 0.001 U87791-1|AAD00645.1| 684|Homo sapiens eRFS protein. 36 0.049 BC040849-1|AAH40849.1| 684|Homo sapiens HBS1-like (S. cerevisia... 36 0.049 BC001465-1|AAH01465.1| 684|Homo sapiens HBS1-like (S. cerevisia... 36 0.049 AL445190-5|CAI95161.1| 684|Homo sapiens HBS1-like (S. cerevisia... 36 0.049 AL445190-4|CAI95162.1| 453|Homo sapiens HBS1-like (S. cerevisia... 36 0.049 AL445190-3|CAI95160.1| 197|Homo sapiens HBS1-like (S. cerevisia... 36 0.049 AL353596-2|CAI17912.1| 684|Homo sapiens HBS1-like (S. cerevisia... 36 0.049 AL353596-1|CAI17913.1| 453|Homo sapiens HBS1-like (S. cerevisia... 36 0.049 AL137664-1|CAB70865.1| 197|Homo sapiens hypothetical protein pr... 36 0.049 AJ459826-1|CAD30873.1| 684|Homo sapiens HBS1-like protein protein. 36 0.049 AB028961-1|BAA82990.1| 496|Homo sapiens KIAA1038 protein protein. 36 0.049 DQ096628-1|AAZ74794.1| 1835|Homo sapiens zipzap protein protein. 29 7.4 AY727870-1|AAU20329.2| 1113|Homo sapiens ARID2 protein. 29 7.4 AL832200-1|CAD91164.1| 1686|Homo sapiens hypothetical protein pr... 29 7.4 >M27364-1|AAA52344.1| 227|Homo sapiens EEF1A protein. Length = 227 Score = 81.0 bits (191), Expect = 2e-15 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VPSKP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 165 AIVDMVPSKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 207 >X16869-1|CAA34756.1| 462|Homo sapiens protein ( Human mRNA for elongation factor 1-alpha (clone CEF4). ). Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >X03558-1|CAA27245.1| 462|Homo sapiens protein ( Human mRNA for elongation factor 1 alpha subunit (EF-1 alpha). ). Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >M29548-1|AAA52367.1| 327|Homo sapiens EEF1A protein. Length = 327 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 265 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 307 >J04617-1|AAA52343.1| 462|Homo sapiens EEF1A protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >EF362804-1|ABO30531.1| 462|Homo sapiens EF1a protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >DQ185041-1|ABD14421.1| 93|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 93 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 31 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 73 >BC111051-1|AAI11052.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC094687-1|AAH94687.1| 308|Homo sapiens EEF1A1 protein protein. Length = 308 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 246 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 288 >BC082268-1|AAH82268.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC072385-1|AAH72385.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC071841-1|AAH71841.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC071741-1|AAH71741.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC071727-1|AAH71727.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC071619-1|AAH71619.1| 441|Homo sapiens EEF1A1 protein protein. Length = 441 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 379 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 421 >BC066893-1|AAH66893.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC065761-1|AAH65761.1| 251|Homo sapiens EEF1A1 protein protein. Length = 251 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 189 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 231 >BC063511-1|AAH63511.1| 290|Homo sapiens EEF1A1 protein protein. Length = 290 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 228 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 270 >BC057391-1|AAH57391.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC038339-1|AAH38339.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC028674-1|AAH28674.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC022412-1|AAH22412.1| 250|Homo sapiens Unknown (protein for IMAGE:4134193) protein. Length = 250 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 188 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 230 >BC021686-1|AAH21686.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC019669-1|AAH19669.1| 462|Homo sapiens EEF1A1 protein protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC018641-1|AAH18641.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC018150-1|AAH18150.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC014892-1|AAH14892.1| 248|Homo sapiens Unknown (protein for IMAGE:3909122) protein. Length = 248 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 186 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 228 >BC014377-1|AAH14377.1| 287|Homo sapiens Unknown (protein for IMAGE:4041545) protein. Length = 287 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 225 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 267 >BC014224-1|AAH14224.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC012891-1|AAH12891.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC012509-1|AAH12509.1| 161|Homo sapiens EEF1A1 protein protein. Length = 161 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 99 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 141 >BC010735-1|AAH10735.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC009875-1|AAH09875.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC009733-1|AAH09733.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >BC008587-1|AAH08587.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >AY043301-1|AAK95378.1| 462|Homo sapiens elongation factor 1-alpha protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >AL603910-8|CAI14883.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >AL593851-4|CAH73620.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha-like 3 protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >AK223046-1|BAD96766.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 variant protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >AK223042-1|BAD96762.1| 433|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 variant protein. Length = 433 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 371 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 413 >AK223030-1|BAD96750.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 variant protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >AK222982-1|BAD96702.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 variant protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >AK222551-1|BAD96271.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 variant protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >AK222523-1|BAD96243.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 variant protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >AK222519-1|BAD96239.1| 366|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 variant protein. Length = 366 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 304 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 346 >AK222515-1|BAD96235.1| 462|Homo sapiens eukaryotic translation elongation factor 1 alpha 1 variant protein. Length = 462 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 442 >AF397403-1|AAK93966.1| 398|Homo sapiens translation elongation factor 1 alpha 1-like 14 protein. Length = 398 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 336 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 378 >AF328730-1|AAN09722.1| 361|Homo sapiens CTCL tumor antigen HD-CL-08 protein. Length = 361 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 299 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 341 >AF322220-1|AAN51932.1| 361|Homo sapiens cervical cancer suppressor 3 protein. Length = 361 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 299 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 341 >AF174496-1|AAF36537.1| 426|Homo sapiens glucocorticoid receptor AF-1 specific elongation factor protein. Length = 426 Score = 79.4 bits (187), Expect = 5e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIKAV+ Sbjct: 364 AIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVD 406 >X70940-1|CAA50280.1| 463|Homo sapiens elongation factor 1 alpha-2 protein. Length = 463 Score = 76.2 bits (179), Expect = 5e-14 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 126 AIV +VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIK V Sbjct: 400 AIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNV 441 >L41498-1|AAC09386.1| 398|Homo sapiens longation factor 1-alpha 1 protein. Length = 398 Score = 76.2 bits (179), Expect = 5e-14 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLG FAVRDMRQTVAVGVIKAV+ Sbjct: 336 AIVDMVPGKPMCVESFSDYPPLGCFAVRDMRQTVAVGVIKAVD 378 >L41490-1|AAC09385.1| 398|Homo sapiens eukaryotic translation elongation factor 1 alpha 1-like 14 protein. Length = 398 Score = 76.2 bits (179), Expect = 5e-14 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLG FAVRDMRQTVAVGVIKAV+ Sbjct: 336 AIVDMVPGKPMCVESFSDYPPLGCFAVRDMRQTVAVGVIKAVD 378 >BC110409-1|AAI10410.1| 463|Homo sapiens eukaryotic translation elongation factor 1 alpha 2 protein. Length = 463 Score = 76.2 bits (179), Expect = 5e-14 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 126 AIV +VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIK V Sbjct: 400 AIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNV 441 >BC000432-1|AAH00432.1| 463|Homo sapiens eukaryotic translation elongation factor 1 alpha 2 protein. Length = 463 Score = 76.2 bits (179), Expect = 5e-14 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 126 AIV +VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIK V Sbjct: 400 AIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNV 441 >AY062434-1|AAL38981.1| 398|Homo sapiens elongation factor 1-alpha 1 protein. Length = 398 Score = 76.2 bits (179), Expect = 5e-14 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 129 AIV++VP KP+CVESF ++PPLG FAVRDMRQTVAVGVIKAV+ Sbjct: 336 AIVDMVPGKPMCVESFSDYPPLGCFAVRDMRQTVAVGVIKAVD 378 >AL121829-9|CAC15522.1| 463|Homo sapiens EEF1A2 protein. Length = 463 Score = 76.2 bits (179), Expect = 5e-14 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 126 AIV +VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIK V Sbjct: 400 AIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNV 441 >AF163763-1|AAF80488.1| 463|Homo sapiens elongation factor 1 A-2 protein. Length = 463 Score = 76.2 bits (179), Expect = 5e-14 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 126 AIV +VP KP+CVESF ++PPLGRFAVRDMRQTVAVGVIK V Sbjct: 400 AIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNV 441 >L10340-1|AAA91835.1| 435|Homo sapiens elongation factor-1 alpha protein. Length = 435 Score = 73.3 bits (172), Expect = 3e-13 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 126 AIV +VP KP+CVESF ++PPLGRFAV DMRQTVAVGVIK V Sbjct: 372 AIVEMVPGKPMCVESFSQYPPLGRFAVPDMRQTVAVGVIKNV 413 >AF267861-1|AAG44730.1| 427|Homo sapiens EF1a-like protein protein. Length = 427 Score = 43.2 bits (97), Expect = 4e-04 Identities = 16/23 (69%), Positives = 21/23 (91%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLG 69 AIV++VP KP+CVESF ++PPLG Sbjct: 400 AIVDMVPGKPMCVESFSDYPPLG 422 >X17644-1|CAA35635.1| 499|Homo sapiens protein ( Human GST1-Hs mRNA for GTP-binding protein. ). Length = 499 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/42 (42%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +1 Query: 4 IVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVG-VIKAV 126 I L + +C+E+F++FP +GRF +RD +T+A+G V+K V Sbjct: 454 IARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLV 495 >U95742-2|AAB67250.1| 499|Homo sapiens G1 to S phase transition protein protein. Length = 499 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/42 (42%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +1 Query: 4 IVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVG-VIKAV 126 I L + +C+E+F++FP +GRF +RD +T+A+G V+K V Sbjct: 454 IARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLV 495 >BT006722-1|AAP35368.1| 498|Homo sapiens G1 to S phase transition 1 protein. Length = 498 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/42 (42%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +1 Query: 4 IVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVG-VIKAV 126 I L + +C+E+F++FP +GRF +RD +T+A+G V+K V Sbjct: 453 IARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLV 494 >BC036077-1|AAH36077.1| 628|Homo sapiens G1 to S phase transition 2 protein. Length = 628 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/42 (42%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +1 Query: 4 IVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVG-VIKAV 126 I L + +C+E+F++FP +GRF +RD +T+A+G V+K V Sbjct: 583 IARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLV 624 >BC009503-1|AAH09503.2| 633|Homo sapiens GSPT1 protein protein. Length = 633 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/42 (42%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +1 Query: 4 IVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVG-VIKAV 126 I L + +C+E+F++FP +GRF +RD +T+A+G V+K V Sbjct: 588 IARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLV 629 >AL929101-2|CAH71524.1| 628|Homo sapiens G1 to S phase transition 2 protein. Length = 628 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/42 (42%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +1 Query: 4 IVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVG-VIKAV 126 I L + +C+E+F++FP +GRF +RD +T+A+G V+K V Sbjct: 583 IARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLV 624 >AK001303-1|BAA91612.1| 628|Homo sapiens protein ( Homo sapiens cDNA FLJ10441 fis, clone NT2RP1000733, highly similar to Human mRNA for GSPT1-TK protein. ). Length = 628 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/42 (42%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +1 Query: 4 IVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVG-VIKAV 126 I L + +C+E+F++FP +GRF +RD +T+A+G V+K V Sbjct: 583 IARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLV 624 >AJ251548-1|CAB91089.1| 628|Homo sapiens polypeptide chain release factor 3b protein. Length = 628 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/42 (42%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +1 Query: 4 IVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVG-VIKAV 126 I L + +C+E+F++FP +GRF +RD +T+A+G V+K V Sbjct: 583 IARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLV 624 >U87791-1|AAD00645.1| 684|Homo sapiens eRFS protein. Length = 684 Score = 36.3 bits (80), Expect = 0.049 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 126 A+V L +P+ +E +++F LGRF +R T+A GV+ + Sbjct: 641 ALVELQTQRPIALELYKDFKELGRFMLRYGGSTIAAGVVTEI 682 >BC040849-1|AAH40849.1| 684|Homo sapiens HBS1-like (S. cerevisiae) protein. Length = 684 Score = 36.3 bits (80), Expect = 0.049 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 126 A+V L +P+ +E +++F LGRF +R T+A GV+ + Sbjct: 641 ALVELQTQRPIALELYKDFKELGRFMLRYGGSTIAAGVVTEI 682 >BC001465-1|AAH01465.1| 684|Homo sapiens HBS1-like (S. cerevisiae) protein. Length = 684 Score = 36.3 bits (80), Expect = 0.049 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 126 A+V L +P+ +E +++F LGRF +R T+A GV+ + Sbjct: 641 ALVELQTQRPIALELYKDFKELGRFMLRYGGSTIAAGVVTEI 682 >AL445190-5|CAI95161.1| 684|Homo sapiens HBS1-like (S. cerevisiae) protein. Length = 684 Score = 36.3 bits (80), Expect = 0.049 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 126 A+V L +P+ +E +++F LGRF +R T+A GV+ + Sbjct: 641 ALVELQTQRPIALELYKDFKELGRFMLRYGGSTIAAGVVTEI 682 >AL445190-4|CAI95162.1| 453|Homo sapiens HBS1-like (S. cerevisiae) protein. Length = 453 Score = 36.3 bits (80), Expect = 0.049 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 126 A+V L +P+ +E +++F LGRF +R T+A GV+ + Sbjct: 410 ALVELQTQRPIALELYKDFKELGRFMLRYGGSTIAAGVVTEI 451 >AL445190-3|CAI95160.1| 197|Homo sapiens HBS1-like (S. cerevisiae) protein. Length = 197 Score = 36.3 bits (80), Expect = 0.049 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 126 A+V L +P+ +E +++F LGRF +R T+A GV+ + Sbjct: 154 ALVELQTQRPIALELYKDFKELGRFMLRYGGSTIAAGVVTEI 195 >AL353596-2|CAI17912.1| 684|Homo sapiens HBS1-like (S. cerevisiae) protein. Length = 684 Score = 36.3 bits (80), Expect = 0.049 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 126 A+V L +P+ +E +++F LGRF +R T+A GV+ + Sbjct: 641 ALVELQTQRPIALELYKDFKELGRFMLRYGGSTIAAGVVTEI 682 >AL353596-1|CAI17913.1| 453|Homo sapiens HBS1-like (S. cerevisiae) protein. Length = 453 Score = 36.3 bits (80), Expect = 0.049 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 126 A+V L +P+ +E +++F LGRF +R T+A GV+ + Sbjct: 410 ALVELQTQRPIALELYKDFKELGRFMLRYGGSTIAAGVVTEI 451 >AL137664-1|CAB70865.1| 197|Homo sapiens hypothetical protein protein. Length = 197 Score = 36.3 bits (80), Expect = 0.049 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 126 A+V L +P+ +E +++F LGRF +R T+A GV+ + Sbjct: 154 ALVELQTQRPIALELYKDFKELGRFMLRYGGSTIAAGVVTEI 195 >AJ459826-1|CAD30873.1| 684|Homo sapiens HBS1-like protein protein. Length = 684 Score = 36.3 bits (80), Expect = 0.049 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 126 A+V L +P+ +E +++F LGRF +R T+A GV+ + Sbjct: 641 ALVELQTQRPIALELYKDFKELGRFMLRYGGSTIAAGVVTEI 682 >AB028961-1|BAA82990.1| 496|Homo sapiens KIAA1038 protein protein. Length = 496 Score = 36.3 bits (80), Expect = 0.049 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = +1 Query: 1 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 126 A+V L +P+ +E +++F LGRF +R T+A GV+ + Sbjct: 453 ALVELQTQRPIALELYKDFKELGRFMLRYGGSTIAAGVVTEI 494 >DQ096628-1|AAZ74794.1| 1835|Homo sapiens zipzap protein protein. Length = 1835 Score = 29.1 bits (62), Expect = 7.4 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 6/57 (10%) Frame = -2 Query: 233 RSCMKNCAVNSSSYFLPLVAF------SAALVTLPPPASLKLTALMTPTATVCLMSR 81 R+C++ +++ S+F+ L + A L P K T LM T T CLMSR Sbjct: 310 RTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFKTTHLMFHTVTKCLMSR 366 >AY727870-1|AAU20329.2| 1113|Homo sapiens ARID2 protein. Length = 1113 Score = 29.1 bits (62), Expect = 7.4 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 6/57 (10%) Frame = -2 Query: 233 RSCMKNCAVNSSSYFLPLVAF------SAALVTLPPPASLKLTALMTPTATVCLMSR 81 R+C++ +++ S+F+ L + A L P K T LM T T CLMSR Sbjct: 310 RTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFKTTHLMFHTVTKCLMSR 366 >AL832200-1|CAD91164.1| 1686|Homo sapiens hypothetical protein protein. Length = 1686 Score = 29.1 bits (62), Expect = 7.4 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 6/57 (10%) Frame = -2 Query: 233 RSCMKNCAVNSSSYFLPLVAF------SAALVTLPPPASLKLTALMTPTATVCLMSR 81 R+C++ +++ S+F+ L + A L P K T LM T T CLMSR Sbjct: 161 RTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFKTTHLMFHTVTKCLMSR 217 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 54,090,334 Number of Sequences: 237096 Number of extensions: 933368 Number of successful extensions: 2331 Number of sequences better than 10.0: 82 Number of HSP's better than 10.0 without gapping: 2294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2331 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3758237868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -