BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30832 (622 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 24 0.89 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 22 4.8 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 4.8 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.8 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 24.2 bits (50), Expect = 0.89 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +2 Query: 167 PTGIRYKRDIS-CYAEDL*SKKTLWRVYIIVTDLLK 271 PT +Y ++ CYA L K LW +Y + D LK Sbjct: 34 PTNQKYYPSLAKCYACLLMVVKILWVIYWLQDDALK 69 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.8 bits (44), Expect = 4.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 556 RLTCRGSGQVDVISHLKKKKK 618 RL G+ +I+HLK KKK Sbjct: 96 RLVWTLPGKTKMIAHLKDKKK 116 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.8 bits (44), Expect = 4.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 556 RLTCRGSGQVDVISHLKKKKK 618 RL G+ +I+HLK KKK Sbjct: 410 RLVWTLPGKTKMIAHLKDKKK 430 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 556 RLTCRGSGQVDVISHLKKKKK 618 RL G+ +I+HLK KKK Sbjct: 643 RLVWTLPGKTKMIAHLKDKKK 663 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 556 RLTCRGSGQVDVISHLKKKKK 618 RL G+ +I+HLK KKK Sbjct: 643 RLVWTLPGKTKMIAHLKDKKK 663 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,307 Number of Sequences: 336 Number of extensions: 2651 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15875032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -