BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30830 (601 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 26 0.81 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 26 1.1 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 26 1.1 AY344840-1|AAR05811.1| 221|Anopheles gambiae TEP4 protein. 25 1.4 AY344839-1|AAR05810.1| 221|Anopheles gambiae TEP4 protein. 25 1.4 AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. 25 1.4 AY344836-1|AAR05807.1| 221|Anopheles gambiae TEP4 protein. 25 1.4 AY344838-1|AAR05809.1| 221|Anopheles gambiae TEP4 protein. 24 3.3 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 10.0 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 10.0 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 26.2 bits (55), Expect = 0.81 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +1 Query: 325 LTSFVTVPTTTAIKPSRVGFFMWRAKRDTEIGGRLIRLIKSRRRTI 462 LT F+ + + T +RVG +W +K E R + IKS+RR + Sbjct: 252 LTYFLPIGSMTYTY-ARVGLELWGSKSIGECTQRQLDNIKSKRRVV 296 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 25.8 bits (54), Expect = 1.1 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 177 LVPVLSSCQSEHEEPADQK*EFLLQQQNACTSFF 278 ++P + Q EH+ PA Q+ LLQQ AC + Sbjct: 1322 IIPDMDLQQMEHQTPAQQQ---LLQQGAACNVLY 1352 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 25.8 bits (54), Expect = 1.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 165 AREAVRHFGPAPGAPRSHTKPYV 97 A E +R + PAP R+ TKPY+ Sbjct: 387 ANETLRKWTPAPFLDRTCTKPYM 409 >AY344840-1|AAR05811.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 592 FIDITHNHDRKVRRTEVKPQD 530 F D+ +N D ++ RTE++P D Sbjct: 2 FEDLRNNFDLQIDRTEIRPGD 22 >AY344839-1|AAR05810.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 592 FIDITHNHDRKVRRTEVKPQD 530 F D+ +N D ++ RTE++P D Sbjct: 2 FEDLRNNFDLQIDRTEIRPGD 22 >AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 592 FIDITHNHDRKVRRTEVKPQD 530 F D+ +N D ++ RTE++P D Sbjct: 2 FEDLRNNFDLQIDRTEIRPGD 22 >AY344836-1|AAR05807.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 25.4 bits (53), Expect = 1.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 592 FIDITHNHDRKVRRTEVKPQD 530 F D+ +N D ++ RTE++P D Sbjct: 2 FEDLRNNFDLQIDRTEIRPGD 22 >AY344838-1|AAR05809.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 592 FIDITHNHDRKVRRTEVKPQD 530 F D+ +N D + RTE++P D Sbjct: 2 FEDLRNNFDLQTDRTEIRPGD 22 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.6 bits (46), Expect = 10.0 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +3 Query: 387 HVARQTRHRDWWPVDTAHKEPA*NDLIEFGICTSGQVSVKLT 512 ++ RQ D W T K+P +D I TS S++L+ Sbjct: 580 YLVRQFDRADQWMEYTYTKDPLTDDYQLSAISTSNTASLQLS 621 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.6 bits (46), Expect = 10.0 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +3 Query: 387 HVARQTRHRDWWPVDTAHKEPA*NDLIEFGICTSGQVSVKLT 512 ++ RQ D W T K+P +D I TS S++L+ Sbjct: 581 YLVRQFDRADQWMEYTYTKDPLTDDYQLSAISTSNTASLQLS 622 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 654,816 Number of Sequences: 2352 Number of extensions: 13932 Number of successful extensions: 24 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -