BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30827 (434 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 2.6 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 4.5 AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 21 7.9 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 7.9 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -1 Query: 404 VGRAHSPPDVKWLLEPIDIYNVDAPPTLRYK 312 +G PPD W + + N D +RYK Sbjct: 98 IGVLRLPPDKVWKPDIVLFNNADGNYEVRYK 128 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 299 SIVTTATPPFKPKRILLHGRNKQ 231 S+V + T PF+P +L N+Q Sbjct: 277 SLVASRTWPFRPSGTVLKDINRQ 299 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 297 TETLELVSQGGWRVHVVDVY 356 T TL L++ ++H VD Y Sbjct: 136 TITLTLLAYQATKIHAVDTY 155 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 20.6 bits (41), Expect = 7.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 203 TSGPTTSNYANYNFAGLIFIT 141 TSG T NY+ F +FI+ Sbjct: 564 TSGATIVNYSIMIFLSAVFIS 584 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,497 Number of Sequences: 438 Number of extensions: 3136 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11368164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -