BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30824 (746 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56571| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) 28 7.0 >SB_56571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = -2 Query: 394 STVTHRKLKFYCNYFV*YQIRCIKTDKFQIKWHFPTKTSRRQTF*ILRQRR 242 +TV R++KF N+F+ Y+ +K+++ + H P F + RR Sbjct: 271 NTVQEREIKFDENFFLGYRKTALKSNEVLVSVHVPFTKQNEYLFAFKQARR 321 >SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) Length = 3369 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -2 Query: 103 SRC*CKGRCTGSCQSASTPSDSFVEP 26 SRC C R TG C P + F +P Sbjct: 3272 SRCVCMARWTGQCCETRLPDEMFGDP 3297 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,966,565 Number of Sequences: 59808 Number of extensions: 367603 Number of successful extensions: 667 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 665 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -