BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30823 (593 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) 53 2e-07 SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 >SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) Length = 120 Score = 53.2 bits (122), Expect = 2e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +1 Query: 163 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKSSLSF 273 MVR+NVL+DAL SI NAEKRGKRQV IRP SK + F Sbjct: 1 MVRVNVLNDALVSICNAEKRGKRQVQIRPSSKVIVKF 37 Score = 31.5 bits (68), Expect = 0.53 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +3 Query: 255 KVIVKFLTVMMKHGYIGEFEIVDDHRAGKIVVN-LTGRLNKCGVISPR 395 KVIVKFLTVMMKH V R G++V +G L+ GV+ R Sbjct: 32 KVIVKFLTVMMKH--------VAQPRIGEMVTRPCSGALSAAGVVVTR 71 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 50.0 bits (114), Expect = 1e-06 Identities = 22/28 (78%), Positives = 25/28 (89%), Gaps = 1/28 (3%) Frame = +3 Query: 375 CGVISPRFDVPINDIERW-TNLLPSRQF 455 CGVISPRFDV + DIE+W +NLLPSRQF Sbjct: 1 CGVISPRFDVGVRDIEQWASNLLPSRQF 28 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,893,283 Number of Sequences: 59808 Number of extensions: 287441 Number of successful extensions: 1283 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1256 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1282 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -